Sequence alignment for CL0188

PF11971

VAV3_MOUSE/18-103PPNHRVTWDSA---------------------------------------------------------------------
CAMP1_HUMAN/229-312HLSARQSPYFP---------------------------------------------------------------------
VAV2_MOUSE/18-103PPNHRVVWPSA---------------------------------------------------------------------
Q4SMI8_TETNG/46-131PPSAPASNLCR---------------------------------------------------------------------
Q1MTA1_DANRE/54-131CQRQTEGYRGV---------------------------------------------------------------------
Q5C317_SCHJA/159-236CQRQTAPYKNV---------------------------------------------------------------------
CAM1B_DANRE/244-327HASGRQLPYFQ---------------------------------------------------------------------
Q4RGQ5_TETNG/186-269PLSGRTLQHFP---------------------------------------------------------------------
Q66HU6_DANRE/210-293HMSGHPVPHLA---------------------------------------------------------------------
A4IIC9_XENTR/222-304KALSRQTPCFT---------------------------------------------------------------------
CAMP3_MOUSE/214-296RAIARRAPCFP---------------------------------------------------------------------
Q4T883_TETNG/253-335RVQSKLTPTFP---------------------------------------------------------------------
Q1LUF1_DANRE/220-301QVLPKCLPWIP---------------------------------------------------------------------
Q4RV77_TETNG/229-312HGQQRSAPSLP---------------------------------------------------------------------
Q4SFF1_TETNG/232-315QASAQPVPWIP---------------------------------------------------------------------
A8XND4_CAEBR/147-231VEREDSVTNIP---------------------------------------------------------------------
A7RQ88_NEMVE/232-316QLQPKIQSLFP---------------------------------------------------------------------
SSP4_DROME/189-272NGSRLQTPDIP---------------------------------------------------------------------
Q16SR6_AEDAE/108-191YGQRLQSPTIA---------------------------------------------------------------------
A0DC81_PARTE/15-97YTWVDIIPLSR---------------------------------------------------------------------
Q22DM0_TETTS/15-97YNWIDGIPLSR---------------------------------------------------------------------
Q4DT05_TRYCC/14-96YLWVDDIPLSR---------------------------------------------------------------------
Q52WZ6_TRYBR/14-96YVWVDEIPISR---------------------------------------------------------------------
A7S652_NEMVE/9-90LKWIQSLDLSH---------------------------------------------------------------------
B1ARM8_MOUSE/1087-1159WVNAVCAFYNK---------------------------------------------------------------------
Q4S6P6_TETNG/521-596WVRAVCDFYGV---------------------------------------------------------------------
A7RIX2_NEMVE/866-936EKHSECCGNHE---------------------------------------------------------------------

PF00307

SMTN_HUMAN/802-906--KQMLLDWCR.AKTR..GY.E..........................................................
O44788_CAEEL/27-138--AIEVLKWIE.NVTG..ER.F..........................................................
PARVG_MOUSE/213-317--QEAIVSFVN.QKLE..RL............................................................
CAMP2_HUMAN/178-335--EDAVMYWIN.KVNE..HL.KDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLPC..........
SPTN2_HUMAN/60-161--KKTFTKWVN.SHLA..RV............................................................
SPTN2_HUMAN/179-281--KDALLLWCQ.MKTA..GY.................................................P..........
MICA3_HUMAN/521-624--SSKLLGWCQ.RQTD..GY.................................................A..........
Q9W204_DROME/174-274--RKLMLAWLQ.AALP................................................................
Q9W204_DROME/277-376--YNATMRWVN.TQV.................................................................
SSP4_DROME/159-291--EQALLGWIS.HACA..AL.KKRIIKEVD...............................AGLPDDNGS.RLQ......
VAV2_HUMAN/4-120--WRQCGRWLI.DCKV..LP.P..........................................................
FIMB_DICDI/119-232--KVAYIDWIN.NCLA..KD.VD.............................................LK..........
FIMB_DICDI/263-365--EEILLRWFN.YHLA..AAGS..........................................................
FIMB_DICDI/382-488--EKTFRNWMN.SLGV..DP............................................................
FIMB_DICDI/504-608--DADIVNWTN.SKLS..AA.G..........................................................
PLSI_HUMAN/269-376--EELLLRWVN.YHLT..NA.G..........................................................
Q18109_CAEEL/17-118--LHTFTNWIN.EQLQ................................................................
Q18109_CAEEL/128-228--KKLVMAWIQ.SALP................................................................
Q18109_CAEEL/231-332--YRATLKKVS.MLLP................................................................
PLST_RAT/126-239--KYAFVNWIN.KALE..NDPD..........................................................
PLST_RAT/270-378--EELLLRWAN.FHLE..NS.G..........................................................
PLST_RAT/400-506--ERTFRNWMN.SLGV..NP............................................................
PLST_RAT/521-627--DDIIVNWVN.GTLS..EAGK..........................................................
EHBP1_HUMAN/446-548--SQSLLVWCK.EVTK..NY.R..........................................................
DMDA_DROME/15-116--KKTFTKWIN.SHLI..DT.Q..........................................................
DMDA_DROME/130-230--EKSLLAWAR.QYTE..PH............................................................
A2AHC4_MOUSE/185-350--EDAMVFWIN.KVNL..KMREITEKEVKLKQQPLESPAH............QKPGLEHAVMHCMLEPVD.FARVVR...
A4IIC9_XENTR/151-323--ETKLLDWID.KVNN..HLLDEAEREQGKKQMSAPEGQNQAG......CPSRWYWKLVPHAIAFCLKES.GNKPPVI.R
CAM1B_DANRE/190-346--EDAMIFWIN.KVNL..KMREITEKEHKSKQHLLES..................PSHQKSPSKWYWKLV.PVRYR....
A7RQ88_NEMVE/187-335--EDALLLWVN.KICT..TLNESHLKQQKQHAE.........................QLLQNQDKAKRF.RFRR.....
O01542_CAEEL/27-133--ATLLLEWIK.KLSG..EN.I..........................................................
O08614_MOUSE/34-135--KKTFTKWIN.ARFS..KS............................................................
O08614_MOUSE/153-255--EKILLSWVR.QTTR..PY.S..........................................................
AIN1_SCHPO/11-114--NRTFTKWFN.TKLS..SR............................................................
AIN1_SCHPO/126-230--KEGLLLWCQ.RKTA..NYHP..........................................................
STG1_SCHPO/6-109--EKEAREWIE.ETLH..TK.L..........................................................
RNG2_SCHPO/44-148--VDEAKKWIE.ECLG..TD............................................................
CTXA_DICDI/11-115--EKAFTAWVN.SVLD..KR............................................................
CTXA_DICDI/127-229--EEGLLLWCK.NTTT..GY.D..........................................................
CTXB_DICDI/12-117--EMAFTSWVN.SVLE..KR............................................................
CTXB_DICDI/129-231--EEGLLAWCK.KTTE..GY.N..........................................................
PARV_CAEEL/102-206--VDLLIYWLN.EELA..DQ............................................................
PARV_CAEEL/269-373--KTSLLAFCN.KHLN..KI............................................................
O17509_BOTSH/17-116--RHDLLGWVN.RSL.................................................................
O17666_CAEEL/339-437--RQSFIENYD.YQA.................................................................
O17772_CAEEL/48-163--CEEVRTWLS.ECLN..DD............................................................
O22260_ARATH/47-166--RYEAANWLR.RMVG..VV.GA.............................................KD.L........
O24399_WHEAT/87-187--EKMLLRWMN.HHLK..KA.G..........................................................
O24399_WHEAT/213-316--ERAFRMWIN.....................................................................
O24399_WHEAT/337-442--DADILNWAN.SKVK..AS.G..........................................................
GAS2_HUMAN/37-157--KEDLALWLT.NLLG..KE............................................................
O44727_CAEEL/30-136--AGYLLEWIR.DLTK..ED.F..........................................................
O49971_ARATH/74-174--EKILLRWMN.FQLR..KT.E..........................................................
O49971_ARATH/199-302--EKAFRFWIN.....................................................................
O49971_ARATH/320-425--DADILEWAN.AKVR..NN.G..........................................................
O50064_ARATH/127-241--KSSYVAHIN.NYLSGDEFLN..........................................................
FIMB_SCHPO/115-233--RREFIKHIN.SVLAGDPDVG..........................................................
FIMB_SCHPO/388-495--ARVFTLWLN.....................................................................
O61604_DROME/128-241--QLAFSDWIN.SNLGHDKDLQ..........................................................
O61604_DROME/272-374--EAILLRWVN.HHLE..RA.G..........................................................
O61604_DROME/394-499--EKTYRNWMN.....................................................................
O61604_DROME/515-620--EKEIVQWVN.NRLS..EA.G..........................................................
LRCH4_HUMAN/537-647--EKDLMTQLR.QVLE..SR............................................................
ACTNB_DICDI/25-128--KKVFTNWCN.IFLN..QR............................................................
ACTNB_DICDI/149-249--SELMLNWVK.SQIS..DY............................................................
O77291_DROME/151-251--KKTFTKWVN.KHLK..KA............................................................
O77291_DROME/266-368--REALLRWAR.RSTA..RY.P..........................................................
O80491_ARATH/57-176--RYEAARWVR.NTLG..VV.GG.............................................RD.L........
ATK4_ARATH/47-163--RYEAAGWLR.DMIG..VS.NG.............................................KD.F........
O93547_XENLA/30-131--ETELKVWIE.EVTG..MS.I..........................................................
O93981_GIBPU/51-169--RTEFTRHIN.AVLAGDADID..........................................................
O93981_GIBPU/200-301--EQILLRWFN.YHLK..AA.N..........................................................
O93981_GIBPU/325-432--ARVFTLWLN.....................................................................
O93981_GIBPU/450-555--DAEMVRWAN.DMSQ..KG.G..........................................................
MICA2_HUMAN/519-622--PSKLLTWCQ.QQTE..GY.Q..........................................................
O96524_TRIVA/18-122--IKVFSRWVQ.KQLL..AR............................................................
O96524_TRIVA/134-235--RDALLLWAK.KNTQ..GY.E..........................................................
O97251_PLAF7/21-120--RKELIEWVN.RYL.................................................................
ACTN1_CHICK/148-251--KEGLLLWCQ.RKTA..PY.K..........................................................
ACTNA_DICDI/25-127--KKTFTAWCN.SHLR..KL............................................................
ACTNA_DICDI/139-242--KEALLLWCQ.RKTE..GY.D..........................................................
ACTN1_HUMAN/34-135--RKTFTAWCN.SHLR..KA............................................................
GELA_DICDI/15-117--KKTFTGWAN.NYLK..ER............................................................
GELA_DICDI/128-227--KAALLEWVR.KQVA..PY............................................................
MP20_DROME/20-123--DKEAQEWIE.AIIA..EK.F..........................................................
VAV_HUMAN/4-120--WRQCTHWLI.QCRV..LPPSH.............................................RV.T........
ACTN_DROME/150-253--KEGLLLWCQ.RKTA..PY.K..........................................................
PLSI_CHICK/125-238--KVAFVNWIN.KALQDDPDCK..........................................................
PLSI_CHICK/269-377--EELLLRWVN.YHLA..NA.G..........................................................
PLSI_CHICK/399-505--ERTFRNWMN.....................................................................
PLSI_CHICK/520-626--DEIIIKWVN.QTLA..NA.N..........................................................
TAGL_CHICK/27-138--EDRLVEWIV.AQCG..SS.V...............................................G..........
CNN1_CHICK/31-132--ERQLRVWIE.GATG..RR.I..........................................................
PLEC_RAT/304-406--KEKLLLWSQ.RMVE..GY.Q..........................................................
FIMB_YEAST/142-259--RREFTKHIN.SVLAGDQDIG..........................................................
FIMB_YEAST/290-390--EQILLRWFN.YHLK..QA.N..........................................................
FIMB_YEAST/414-521--ARVFTLWLN.....................................................................
FIMB_YEAST/537-642--DSQILKWAQ.DQVT..KG.G..........................................................
TAGL2_HUMAN/27-137--EQILIQWIT.TQCR..KD.V...............................................G..........
BIM1_YEAST/9-107--RTELLTWLN.GLL.................................................................
LRCH1_FELCA/134-245--EKELVEHLR.ESIE..MR............................................................
IQGA1_HUMAN/47-160--LEEAKRWME.ACLG..ED............................................................
P90545_ENTHI/11-113--KKTFTKWAN.VQLS..GA............................................................
P90545_ENTHI/123-223--KNALLEWVN.SKLT................................................................
P91888_SCHMA/27-143--EAEAINWLN.QLTN..EN.V..........................................................
SPTCB_DROME/172-274--KDALLLWCQ.MKTA..GY.H..........................................................
Q03486_PHYPO/10-112--EKAFTAWVN.GVLKHVDE............................................................
Q03486_PHYPO/124-226--EEGLLLWCK.NTTA..GY.D..........................................................
SCP1_YEAST/29-137--IQNIKIWVYKSVLK..EI............................................................
MAL3_SCHPO/5-103--RQELLAWIN.QVT.................................................................
YBX7_SCHPO/67-171--VHEAKKWLEEETNN..EY............................................................
IQG1_YEAST/111-218--VSEVKIWIE.AVIE..EA............................................................
ARHG6_HUMAN/4-111--EEQIVTWLI.SLGV..LE..S.............................................PK.K........
CNN3_HUMAN/29-130--EEDLRNWIE.EVTG..MS.I..........................................................
Q16SR6_AEDAE/65-210--EAALLSWIS.HVCS..ALKRRIDYELTNGV...........................GGGNGGGGGTN.PAVD.....
Q19011_CAEEL/279-368--LDSLLKQVE.DAYS................................................................
Q19816_CAEEL/342-462--RNVLLMWVQ.EKLE..LY.S..........................................................
Q23158_CAEEL/153-254--RDGLLLWCQ.RKTA..PY.N..........................................................
Q24109_DROME/408-509--RLSLLRWCQ.ERVK..PY............................................................
MYPH_ECHGR/27-131--ENEALEWIE.ALTG..LK.L..........................................................
Q26574_SCHMA/114-231--ERGFTLWIN.KRLGHDVELQ...............................................D..........
Q26574_SCHMA/262-375--EELLMRWVN.YHLH..RA.G..........................................................
Q26574_SCHMA/393-498--ERTYRNWIN.....................................................................
Q26574_SCHMA/516-618--DKDILTWVN.EQMM..EA............................................................
VAV_CAEEL/40-151--WIGCARWLR.DMKV..LTTD..........................................................
Q4RGQ5_TETNG/132-288--EDAMLLWIN.KVTM..KMREILEKELKMKHHLLES..................PSHQKSPSKWYWKLV.PMRYR....
Q4RHF5_TETNG/170-327--EDTMLHWVN.VINQ..KLRESNKEAQTDASQAITE.................SELVQPSCPTRWYWKL.FPLRY....
Q4RV77_TETNG/184-331--EDAIVTWIN.KVNE..HLRGHPGGGAEAGET.........................TSQESNSTAQKA.RYRK.....
Q4SFF1_TETNG/178-334--EDAVTTWIN.RVNE..YLKEIVTQEQKREAQSAEP..................AGSPRSPTKWYMKLV.PARYR....
Q4T883_TETNG/176-354--ENALLFWVN.RLNQ..KLRELTEEEEEEPASRPQTCSDVQPAQ..DAQCPSTRWYWKLVPHAIAFCLKESGNKPPVIR
PLSL_MOUSE/267-375--EELLLRWAN.YHLE..NA.G..........................................................
PLSL_MOUSE/518-624--DDIIVNWVN.TTLK..EA.Q..........................................................
Q66HU6_DANRE/156-312--EDAALFWIN.KVVL..KTRDLSEKELKMKQPLMDS..................PCHQKSPSKWYWKLV.PVRYR....
PLSL_DANRE/516-621--DETIVQWVN.ETLT..QA.G..........................................................
FIMB1_ARATH/126-240--KGPFVQHIN.RYLGDDPFLK..........................................................
FIMB1_ARATH/271-371--EKVLLKWMN.FHLK..KG.G..........................................................
MILK1_HUMAN/5-108--RGALLAWCR.RQCE..GY.R..........................................................
MICA1_HUMAN/511-612--QEELLRWCQ.EQTA..GY.P..........................................................
Q90574_CHICK/38-141--QNTFTRWCN.EHLR..CV............................................................
Q90574_CHICK/161-261--KQRLLGWIQ.NKIP................................................................
Q966J8_CAEEL/168-289--VDALLFWIN.KICL..LVRDD.............................................VE.R........
CLMN_HUMAN/35-139--KRTFTRWIN.LHLEKCNP............................................................
CLMN_HUMAN/190-291--IKALLAWVQ.RKTR..KY............................................................
Q99140_DROME/40-140--KKTFTKWMN.SFLI..KA............................................................
Q99140_DROME/161-265--KDALLLWCQ.RKTH..GY.P..........................................................
CNN2_HUMAN/31-132--EAELRTWIE.GLTG..LS.I..........................................................
GA2L1_HUMAN/30-148--KEDLAEWLN.ALYGLGLP............................................................
SMTL1_MOUSE/346-449--KNMLLEWCR.AMTR..NY.E..........................................................
EH1L1_MOUSE/1214-1316--SQSLLEWCQ.EVTN..GY.R..........................................................
Q9BK91_STRPU/37-138--KKTFSKWVN.AQLV..QE............................................................
Q9BK91_STRPU/155-257--EKTVLTWCK.EATR..GY.E..........................................................
Q9DGM6_DANRE/184-286--KDALLLWCQ.MKTA..GY.P..........................................................
PARVA_MOUSE/98-202--MKVLIDWIN.DVLV..GE............................................................
PARVA_MOUSE/265-369--KKTLITFVN.KHLN..KL............................................................
PARVB_MOUSE/91-195--VKVLLDWIN.DVLA..EE............................................................
FIMB3_ARATH/396-499--ERCYRLWIN.....................................................................
FIMB2_ARATH/125-239--KASYVSHVN.NYLRDDPFLK..........................................................
FIMB2_ARATH/270-370--EKVLLKWMN.FHLK..KA.G..........................................................
FIMB2_ARATH/516-621--DADILNWAN.RKVK..RG.G..........................................................
Q9GQV2_DROME/18-120--QNTFTRWAN.EHLK..TI............................................................
Q9GQV2_DROME/142-242--KQRLLNWIH.AKIP................................................................
SPTN4_HUMAN/183-285--KDALLLWCQ.MKTA..GY.P..........................................................
PARVG_HUMAN/47-151--QKVLMEWIN.ATLL..PE............................................................
Q9I7J0_DROME/9-111--EQEVLNWVF.AVIG..EK............................................................
ANC1_CAEEL/26-130--KNTFTRWIN.FHLE..EHSS...............................................S..........
ANC1_CAEEL/225-328--EQVFLRWIN.AEIG..DL.V..........................................................
VAV_DROME/21-137--WRECVAWLT.RCKV..IPPDH.............................................KA.A........
SPTN5_HUMAN/57-159--EKTFTKWIN.NVFQCGQA............................................................
SPTN5_HUMAN/180-282--KEALLVWCQ.RKTA..SY.T..........................................................
CAMP3_HUMAN/166-315--EHKLLFWVD.TTVR..RLQEKTEQEAAQRASP.......................AAPADGAAPAQPS.IRYR.....
Q9SJ84_ARATH/391-494--ERCFRHWMN.....................................................................
Q9SS42_ARATH/22-140--RFQAVQWLK.SVVG..QL.G...............................................I..........
DMD_CAEEL/132-234--SEAIKQWCI.EVMK..SY.E..........................................................
Q9TYW4_CAEEL/29-132--QNTFTRWVK.NHLQ..KA............................................................
Q9TYW4_CAEEL/153-253--KQKLLNWIR.NRLP................................................................
Q9U3Z8_ENTHI/13-114--LRTYTNWVN.YNLG................................................................
Q9U3Z8_ENTHI/132-229--NNALLDWVN.SF..................................................................
Q9U5G9_TETTH/87-200--VNAYCEHIN.YYLSDDADLK..........................................................
Q9U5G9_TETTH/231-330--EELLIRWFN.YHLE..NA.K..........................................................
Q9U5G9_TETTH/358-460--ERVFRMWMN.....................................................................
Q9U5G9_TETTH/469-571--EQKLVEWGN.SRIP..Q.............................................................
TAGL3_HUMAN/27-137--ENKLVDWII.LQCA..ED.I...............................................E..........
VAV3_HUMAN/4-120--WKQCAQWLI.HCKV..LPTNH.............................................RV.T........
MARE3_HUMAN/17-116--RHDMLAWVN.DSL.................................................................
Q9VU34_DROME/13-116--TKALEYWCR.VVTQ..GY.N..........................................................
Q9VWD0_DROME/93-197--QRILVDWIN.DELA..EQ............................................................
Q9VWD0_DROME/260-364--KKSLITFVN.KHLA..KL............................................................
Q9VZI1_DROME/28-134--AQESLEWIK.AVTE..EP.I..........................................................
Q9W2W2_DROME/21-120--RGDILDWFN.ETL.................................................................
Q9XXA2_CAEEL/17-115--RKEAVAWVN.NLL.................................................................
Q9XZ57_DROME/17-116--RHDMLAWVN.DCL.................................................................
Q9XZE9_HYDVU/33-146--LEEARIWLE.GCIH..EE............................................................
Q9YGW4_CHICK/40-143--QNTFTRWCN.EHLK..CV............................................................
Q9YGW4_CHICK/162-262--KQRLLGWVQ.HRVP................................................................

PF06294

SPEF2_MOUSE/5-158-----LCQWLNQELRVSRTV------------------------------------------------------------
SPEF2_HUMAN/5-153-----LCQWLNKELKVSRTV------------------------------------------------------------
SPAT4_MOUSE/54-210-----VLRWLQG...LDLSF------------------------------------------------------------
SPEF1_MOUSE/13-164-----LYLWVDN...IPLSR------------------------------------------------------------
Q9VXK2_DROME/17-174-----VNKWMQQ.....NSI------------------------------------------------------------
Q9VT31_DROME/9-158-----LNQWLKE....QRII------------------------------------------------------------

PF06395

A5DJC8_PICGU/101-185--DPVTHLWKL---------------------------------------------------------------------
Q0UQ03_PHANO/151-242--DPVTLLWRT---------------------------------------------------------------------
Q6BPP7_DEBHA/160-246--DPATHLWKM---------------------------------------------------------------------
A7TRQ3_VANPO/182-268--DPVTQLSQL---------------------------------------------------------------------
A5E275_LODEL/193-281--DPVTQIWKL---------------------------------------------------------------------
A2QIY3_ASPNC/61-149--DPVASLWNC---------------------------------------------------------------------
Q6CBW7_YARLI/151-244--DPVTQLWSL---------------------------------------------------------------------
A3LZC0_PICST/155-241--DPATLMWKL---------------------------------------------------------------------
Q4PBU1_USTMA/157-246--DPVTQLWQC---------------------------------------------------------------------
A7EK75_SCLS1/142-230--DPVSSLWRC---------------------------------------------------------------------
Q6FIT2_CANGA/203-289--DPITQLSQL---------------------------------------------------------------------
Q7S4Y3_NEUCR/92-181--GPVEALWKL---------------------------------------------------------------------
Q0MQZ9_PENMA/62-150--DPVNSLWTC---------------------------------------------------------------------
Q59YK6_CANAL/166-252--DPATHLWKL---------------------------------------------------------------------
Q9HF59_ASHGS/151-237--DPVTELSKL---------------------------------------------------------------------
Q2GPG0_CHAGB/100-189--GPVESLWKL---------------------------------------------------------------------
SCD1_SCHPO/105-194--DPVTEIWLF---------------------------------------------------------------------

PF11971

VAV3_MOUSE/18-103----------QVF-------DL-AQTLRDGVLLCQLLNNL-RP------HS---------I-NLKEINLRP---------
CAMP1_HUMAN/229-312----------LLE-------DL-MRDGSDGAALLAVIHYY-CP------EQ---------M-KLDDICLKE---------
VAV2_MOUSE/18-103----------VVF-------DL-AQALRDGVLLCQLLHNL-SP------GS---------I-DLKDINFRP---------
Q4SMI8_TETNG/46-131----------QVC-------DL-AQALRDGVLLCQLLNNL-LP------QA---------V-NLREINLRP---------
Q1MTA1_DANRE/54-131----------SVS-------DL-TTSWKSGLALCALIHRY-RP------DL---------I-DF......E---------
Q5C317_SCHJA/159-236----------RVE-------NF-HTSFKDGLAFCAIIHRN-RP------QI---------I-NY......S---------
CAM1B_DANRE/244-327----------MLE-------DL-IRDVCDGAALLTVVHYY-CP------EL---------M-KLDDICLKE---------
Q4RGQ5_TETNG/186-269----------LLH-------DL-LRDVSDGMALLAVTHFY-CP------EL---------V-KLEDICLKE---------
Q66HU6_DANRE/210-293----------VME-------DL-MKDICDGAALLAVIHFY-CP------EY---------M-RLDDICLKE---------
A4IIC9_XENTR/222-304----------AVS-------SL-.RDLSNGSALAATVHYY-CP------AQ---------L-RLQDICLKD---------
CAMP3_MOUSE/214-296----------NVT-------TL-.QDLASGAALAATIHCY-CP------QL---------L-RLEEVCLKD---------
Q4T883_TETNG/253-335----------LVY-------GV-.KDLSNGCAIASVLHYY-CP------GL---------L-PLEDVCLKD---------
Q1LUF1_DANRE/220-301----------PVD-------NL-LKDSTDGCALAALLHFY-CP------TT---------V-..SHICLNE---------
Q4RV77_TETNG/229-312----------LVE-------NL-LKDNTDGCALTTLLHFY-CS------TV---------I-RLDDICLKE---------
Q4SFF1_TETNG/232-315----------PVD-------NL-LKDSSDGSALAALLHFY-CP------QL---------L-QLSDVCLKE---------
A8XND4_CAEBR/147-231----------EME-------DL-YEDISDGQCLCALLHWY-RP------QE---------M-PVADISFNE---------
A7RQ88_NEMVE/232-316----------VID-------DL-LKDLSDGQCLLAIIMFY-HP------DA---------I-KFEDIHFGR---------
SSP4_DROME/189-272----------PVR-------DF-.QDLCDGICLALLISYY-CP------KV---------V-PWTSVRINY---------
Q16SR6_AEDAE/108-191----------PVR-------DF-.RELCDGVCLAYLISYY-CP------KL---------V-PWHSVKFNH---------
A0DC81_PARTE/15-97----------PKK-------NI-GRDFADGVLMAEIVHHY-FP------KL---------V-ELHNYS..Q---------
Q22DM0_TETTS/15-97----------PKK-------NI-TRDFADGCMLAEVISHY-CP------KL---------V-EVHNYS..Q---------
Q4DT05_TRYCC/14-96----------PKR-------NI-TRDFSDGCCVAEVVKFF-FP------RL---------V-DLHNYT..P---------
Q52WZ6_TRYBR/14-96----------PKR-------NI-TRDFSDGCCVAEVMKFF-FP------KL---------V-ELHNYV..P---------
A7S652_NEMVE/9-90----------PVK-------NT-KRDFSNGCLVAEIFSWY-YP------QE---------I-QMHSYD..N---------
B1ARM8_MOUSE/1087-1159----------KVE-------NF-TVSFSDGRILCYLIHHY-HP------CY---------V-PFDAICQRT---------
Q4S6P6_TETNG/521-596----------KVE-------NF-TVSFSDGRVLCYLVHHY-HP------SL---------L-PDKSVSLLT---------
A7RIX2_NEMVE/866-936----------AID-------NF-TVSFSDGRALCYLLHHY-HP------AL---------L-PLSAIRQET---------

PF00307

SMTN_HUMAN/802-906.......HV.DIQ.......NF.SSSWSDGMAFCALVHNF.FP---...EA.........F.DYGQL..SP......Q..
O44788_CAEEL/27-138.......SF.DVTTCE.SSTDV.SNLLKDGVMLCKLIEKL.DP---...S..........C.RVVYN..........KKP
PARVG_MOUSE/213-317.......GL.SVQ.......SL.DTQFADGVILLLLIGQL.EG---...FF.........L.HLKEF..........YLT
CAMP2_HUMAN/178-335.......IP.LVE.......NL.LKDGTDGCALAALIHFY.CP---...DV.........V.RLEDI..........CLK
SPTN2_HUMAN/60-161.......TC.RVG.......DL.YSDLRDGRNLLRLLEVL.SG---...EI.........L.PKPTK..GR......MR.
SPTN2_HUMAN/179-281.......NV.NVH.......NF.TTSWRDGLAFNAIVHKH.RP---...DL.........L.DFESL..KK......C..
MICA3_HUMAN/521-624.......GV.NVT.......DL.TMSWKSGLALCAIIHRY.RP---...DL.........I.DFDSL..DE......Q..
Q9W204_DROME/174-274.......DC.RIT.......NL.TTDWNSGVNLAALLDYC.QP---...GL.........FPHWRSL..DP......S..
Q9W204_DROME/277-376.......KD.PVK.......NF.TTDWNDGRVMCEIIKGL.GG---...SA.........P.APEKL..........STD
SSP4_DROME/159-291....TPDIP.PVR.......DF..QDLCDGICLALLISYY.CP---...KV.........V.PWTSV..RI......NYL
VAV2_HUMAN/4-120.......NH.RVVWPSAVVFDL.AQALRDGVLLCQLLHNL.SP---...GS.........I.DLKDINFRP......QMS
FIMB_DICDI/119-232......SRL.PIPED...GDKF.FAACNDGLLLCKLINDA.VP---...DT.........I.DERVL..NK......KNL
FIMB_DICDI/263-365.......QR.RVK.......NF.SGDIKDSECYTILLKQI.AP---...KDA.......GV.ETSAL..NI......S..
FIMB_DICDI/382-488..........FVN.......NL.YEGTYDGLILIQLFDKI.YP---...GL.........V.DHKKVNYPP......YKA
FIMB_DICDI/504-608.......KK.QIS.......GFKDSTISTGIPILDVIEAV.RP---...GS.........V.DPALVATSG......SA.
PLSI_HUMAN/269-376.......WH.TIS.......NF.SQDIKDSRAYFHLLNQI.AP---...KGGEDG.PAIAI.DLSGI..NE......T..
Q18109_CAEEL/17-118.......GN.VIR.......DL.TQDLSDGVNLIKLVEIL.QG---...RR.........Y.YGKVYDQDP......TE.
Q18109_CAEEL/128-228.......EL.KLT.......NF.RTNWNDGIALSALLEYC.QP---...GL.........CPEWRNL..DP......S..
Q18109_CAEEL/231-332.......DC.NVD.......DL.EHSWSDGFLLAHLVEIC.GG---...RV.........P.ELERM.RFD......NL.
PLST_RAT/126-239.......CR.HVIPMNPNTDDL.FKAVGDGIVLCKMINLS.VP---...DT.........I.DERAI..NK......KKL
PLST_RAT/270-378.......WQ.KIN.......NF.SADIKDSKAYFHLLNQI.AP---...KGQKEGEPRIDI.NMSGF..NE......T..
PLST_RAT/400-506..........HVN.......HL.YVDLQDALVILQLYERI.KV---...P..........V.DWSKV..........NKP
PLST_RAT/521-627.......ST.SIQ.......SFKDKTISSSLAVVDLIDAI.QP---...GC.........I.NYDLV.KTG......NLT
EHBP1_HUMAN/446-548.......GV.KIT.......NF.TTSWRNGLSFCAILHHF.RP---...DL.........I.DYKSL..NP......Q..
DMDA_DROME/15-116.......CT.PVK.......DL.FLDLRDGHRLLALLSTL.TQ---...TN.........L.KPEKG...R......MR.
DMDA_DROME/130-230.......GL.QLN.......DF.SSSWSDGRAFLMILDAH.VE---...EL...........NLQAA..LQ......Q..
A2AHC4_MOUSE/185-350YRREHLSAR.QSPYFP.LLEDL.MRDGSDGAALLAVVHYY.CP---...EQ.........M.KLDDI..........CLK
A4IIC9_XENTR/151-323YRKDKALSR.QTPCFT.AVSSL..RDLSNGSALAATVHYY.CP---...AQ.........L.RLQDI..........CLK
CAM1B_DANRE/190-346..RDHASGR.QLPYFQ.MLEDL.IRDVCDGAALLTVVHYY.CP---...EL.........M.KLDDI..........CLK
A7RQ88_NEMVE/187-335...DQLQPK.IQSLFP.VIDDL.LKDLSDGQCLLAIIMFY.HP---...DA.........I.KFEDI..........HFG
O01542_CAEEL/27-133......STS.GER.......DNFHNLLKDGTLLCKAANGI.EA---...G............SIKKV..........QKP
O08614_MOUSE/34-135.......GKPPIS.......DM.FSDLKDGRKLLDLLEGL.TG---...TS.........L..PKERGS........TR.
O08614_MOUSE/153-255.......QV.NVL.......NF.TTSWTDGLAFNAVLHRH.KP---...DL.........F.DWDEM..VK......M..
AIN1_SCHPO/11-114.......DLPSVF.......DL.RKDLSDGILLIQLLEII.GD---...EN.........L..GRYNRNPR......MR.
AIN1_SCHPO/126-230.......EV.DVQ.......DF.TRSWTNGLAFCALIHQH.RP---...DL.........L.DYNKL..DK......K..
STG1_SCHPO/6-109......N....AQ.......LDLLDQLQSGVILCRICKEA.LG---...A............NIRY...........KES
RNG2_SCHPO/44-148........L.GPT.......STFEQSLRNGVVLALLVQKF.QP---.......................DKLIKIFYSNE
CTXA_DICDI/11-115.......GE.KIS.......DV.GKDLSDGVKLIFFLELI.SS---...KK.........F.NKKYDFEPK......AR.
CTXA_DICDI/127-229.......GV.NIT.......SF.TKSFRDGLAFLALSHKF.EP---...ES.........F.KFQEF..EA......M..
CTXB_DICDI/12-117.......GCDKIS.......DV.STDLSDGVKLIYFLESV.SG---...KK.........F.PKKFDLEPK......TR.
CTXB_DICDI/129-231.......NV.NIT.......GF.KSSFRDGHGFLALAHKY.DP---...TV.........F.KYDEY..EG......H..
PARV_CAEEL/102-206.......RI.VVR.......HL.QEDLFDGQIIQKLLEKL.EQ---...IR.........I.EVPEVSQSE......E..
PARV_CAEEL/269-373......NL..EVS.......DL.DNQFQDGVFLVLLVGLL.EG---...YF.........V.PLYHFNLQV......QS.
O17509_BOTSH/17-116.......DL.NLT.......KV..EQLCSGAVYCQFMHML.FD---...TK.........I.NIRKVKWES......KL.
O17666_CAEEL/339-437....................KG.FSDFSDGLILAKLLETV.GE---MPHGQ.........I.LLKLRDPAG......DR.
O17772_CAEEL/48-163.......TL.VPT.......TDLEENLRNGVLLARLGNSF.AP---...EV...........VPEKGIFDIRQEKYRQND
O22260_ARATH/47-166......PAE.PTE.......EGLRLGLRSGIILCKVLNKV.QP---...G............AVSKVVESPCDAILVADG
O24399_WHEAT/87-187......YKK.TVN.......NF.SSDVKDGEAYAYLLKAL.AP---...ET.........S.PETTL..ET......K..
O24399_WHEAT/213-316.......SL.GVESY...LNNV.FEDVRNGWVLLEVLDKV.SP---...GS.........V.NWKLESKPP......IKL
O24399_WHEAT/337-442......RTS.RME.......SFKDKSLSNGVFFLELLSAV.QP---...RVVN....WKVV..TKGE..AD......E..
GAS2_HUMAN/37-157..........ITA.......ETFMEKLDNGALLCQLAETM.QE---KFKES.........MDANKPTKNLPLKKIPCKTS
O44727_CAEEL/30-136......DCE.ASR.......DNFREQLKDGQRLCKLVNAI.KA---...G............SVKKI..........MKP
O49971_ARATH/74-174......YKK.TVT.......NF.SSDVKDAEAYTNLLNVL.AP---...EH.........K.NPSHL..AV......K..
O49971_ARATH/199-302.......SF.DGSVY...INNV.FEDLRDGWILLQTLDKV.SP---...GI.........V.NWKVSSKPP......IKL
O49971_ARATH/320-425......CKT.RMY.......SFRDKSLSDGVFFLELLSSV.QP---...RSVN....WSLV..TNGV..TD......E..
O50064_ARATH/127-241......KCL.PINPS...SNDL.FEVAKDGVLLCKLINVA.VP---...GT.........I.DERAINTK.........S
FIMB_SCHPO/115-233......SRV.PINTE...TFEF.FDQCKDGLILSKLINDS.VP---...DT.........I.DERVLNKQ.......RNN
FIMB_SCHPO/388-495.......SL.DVTPS...IHDF.FNNLRDGLILLQAYDKI.TP---...NT.........V.NWKKVNKAP......ASG
O61604_DROME/128-241......HLL.PIDSE...GKRL.YLSIKDGILLCKIINHS.CP---...DT.........I.DERAINK..........K
O61604_DROME/272-374......ISR.RCT.......NF.QSDIVDSEIYSHLLKQI.AG---...NDA.......DV.NLDAL..RE......S..
O61604_DROME/394-499.......SM.GVAPH...VNWL.YSDLADGLVIFQLFDVI.KP---...GI.........V.NWSRVHKRF......SPL
O61604_DROME/515-620......KQS.QLR.......NFNDPAIADGKIVIDLIDAI.KE---...GSIN....YELV.RTSGT..QE.........
LRCH4_HUMAN/537-647......LQR.PLP.......EDLAEALASGVILCQLANQL.RP---...R............SVPFIHVPS......PAV
ACTNB_DICDI/25-128.......SQ.KIE.......DL.ETDLYDGILLGSLLEIL.SG---...KN.........V.ILSKCKQLK......TR.
ACTNB_DICDI/149-249.......GH.HIK.......DL.TTSFQNGLLFCALVHKL.VP---...EK.........L.DYKSL..SE......S..
O77291_DROME/151-251.......NR.RVV.......DL.FEDLRDGHNLLSLLEVL.SG---...EH.........L..PREKGK........MR.
O77291_DROME/266-368.......GV.RVN.......DF.TSSWRDGLAFSALVHRN.RP---...DL.........L.DWRKA..RN......D..
O80491_ARATH/57-176......PAD.PSE.......EDFRIALRSGILLCNVLNRV.KP---...G............AVPKVVEAPNDPLVNQDG
ATK4_ARATH/47-163......PGE.PSE.......EEFRLGLRSGIVLCNVLNKV.NP---...G............SVSKVVEAPD...DVADG
O93547_XENLA/30-131......G.............PDFQKGLKDGVILCELMNKL.RP---...R............AIPKV..........NVS
O93981_GIBPU/51-169......SRL.PFPTD...TFEM.FDECKDGLVLAKLINDS.VP---...DT.........I.DERVLNIPG......RKI
O93981_GIBPU/200-301......WSR.TVN.......NF.SSDVKDGENYAVLLAQI.GP---...EY........GV.TRAPL..QK......Q..
O93981_GIBPU/325-432.......SL.DVQPA...VVSF.FDDLRDGGVLLQAYEKV.IP---...NS.........V.NPRHVNKRP......AHG
O93981_GIBPU/450-555......RNS.AIR.......SLKDPSIGSGIFLLDVLNGM.KS---...SYVD....YDLV..TAGQ..TD......E..
MICA2_HUMAN/519-622.......HV.NVT.......DL.TTSWRSGLALCAIIHRF.RP---...EL.........I.NFDSL..NE......D..
O96524_TRIVA/18-122.......QI.QFE.......TI.ETDFEDGTKLLNLLEII.GK---...EP.........M.PSKWHKQPK......MM.
O96524_TRIVA/134-235.......HV.AVN.......NF.TTSWNTGLAFAALINKF.RP---...NL.........L.DYSAL..DY......N..
O97251_PLAF7/21-120.......KL.NIT.......KV..EQCSNGAIYIQLLDIL.FP---...NK.........S.VLHKAKWNA......KM.
ACTN1_CHICK/148-251.......NV.NIQ.......NF.HISWKDGLGFCALIHRH.RP---...EL.........I.DYGKL..RK......D..
ACTNA_DICDI/25-127.......GS.SIE.......QI.DTDFTDGIKLAQLLEVI.SN---...DP.........V..FKVNKTPK......LR.
ACTNA_DICDI/139-242.......RV.KVG.......NF.HTSFQDGLAFCALIHKH.RP---...DL.........I.NFDSL..NK......D..
ACTN1_HUMAN/34-135.......GT.QIE.......NI.EEDFRDGLKLMLLLEVI.SG---...ER.........L..AKPERG.K......MR.
GELA_DICDI/15-117.......IL.KIE.......DL.ATSLEDGVLLINLLEII.SS---...KK.........I..LKYNKAPK......IR.
GELA_DICDI/128-227.......KV.VVN.......NF.TDSWCDGRVLSALTDSL.KP---...G..........VREMSTL..TG.........
MP20_DROME/20-123......P....AG.......QSYEDVLKDGQVLCKLINVL.SP---...N............AVPKV..........NSS
VAV_HUMAN/4-120......WDG.AQV.......CELAQALRDGVLLCQLLNNL.LP---..HAI...........NLREV..........NLR
ACTN_DROME/150-253.......NV.NVQ.......NF.HLSFKDGLAFCALIHRH.RP---...DL.........I.DYAKL..SK......D..
PLSI_CHICK/125-238......HIL.PMNPS...DASL.FKSLADGILLCKMINFS.QP---...DT.........I.DERAINK..........K
PLSI_CHICK/269-377......W.Q.KIS.......NF.SQDIRDSRAYYHLLNQI.AP---...KGDDFDEIHVEI.DFSGF..ND......K..
PLSI_CHICK/399-505.......SL.GVSPY...VNHL.YSDLSDALIIFQLYEMTRVP---..............V.DWTHVNKRP......YPL
PLSI_CHICK/520-626......KKT.SIT.......SFKDKSISTSLPVLDLIDAI.AP---...KAVR....QEMV.KREDL..SY......Q..
TAGL_CHICK/27-138......RPD.RGR.......LGFQVWLKNGIVLSQLVNSL.YP---DGSK............PV.KI..........PDS
CNN1_CHICK/31-132......G.............DNFMDGLKDGVILCELINKL.QP---...G............SVQKV..........NDP
PLEC_RAT/304-406.......GL.RCD.......NF.TTSWRDGRLFNAIIHRH.KP---...ML.........I.DMNKV..YR......Q..
FIMB_YEAST/142-259......DLL.PFPTD...TFQL.FDECRDGLVLSKLINDS.VP---...DT.........I.DTRVLNWP.......KKG
FIMB_YEAST/290-390......WNR.RVT.......NF.SKDVSDGENYTILLNQL.DP---...A.........LC.SKAPL..QT......T..
FIMB_YEAST/414-521.......SL.DVDPP...VISL.FDDLKDGLILLQAYEKV.MP---...GA.........V.DFKHVNKRP......ASG
FIMB_YEAST/537-642......KNS.TIR.......SFKDQALSNAHFLLDVLNGI.AP---...GYVD....YDLV..TPGN..TE......E..
TAGL2_HUMAN/27-137......RPQ.PGR.......ENFQNWLKDGTVLCELINAL.YP---EGQA............PVKKI..........QAS
BIM1_YEAST/9-107.......NL.NYK.......KI..EECGTGAAYCQIMDSI.YG---...DL...........PMNRVKFNA......TA.
LRCH1_FELCA/134-245......LKV.SLH.......EDLGAALMDGVVLCHLVNHI.RP---...R............SVASIHVPS......PAV
IQGA1_HUMAN/47-160........L.PPT.......TELEEGLRNGVYLAKLGNFF.SP---...KV...........VSLKKIYDREQTRYKATG
P90545_ENTHI/11-113.......YV..IN.......DV.ETDLNDGLILISLFEAL.RK---...QK.........V.QFRYNKKPK......MR.
P90545_ENTHI/123-223.......SR.KIK.......SF.SNDWNTGDVLNELIHAL.EP---...DF.........I.DLADSASKG.........
P91888_SCHMA/27-143......P...FGR.......ENVAAASKNGQISIKLINVV.FD---...G............TASLPSAAAKMKRPFKAN
SPTCB_DROME/172-274.......NV.NVR.......NF.TTSWRDGLAFNAIIHKH.RP---...DL.........V.QFEKL..SK......T..
Q03486_PHYPO/10-112..........KVT.......DI.TQDFSDGIKLAHFLELL.SG---...KK...........MPKKPEEAR......SR.
Q03486_PHYPO/124-226.......GV.DIK.......SF.KTGFRDGHAFLALAHKY.DP---...AQ.........F.NYDEL..NK......L..
SCP1_YEAST/29-137..........APP.......GDLLECLKDGTVLCKLANIL.YE---ADTG............EANHI..........SWK
MAL3_SCHPO/5-103.......SL.GLT.......RI..EDCGKGYAMIQIFDSI.YQ---...DI...........PLKKVNFEC......NN.
YBX7_SCHPO/67-171..........QNL.......DDFVDALVNGKVLCQLAFKY.YP---................KLASNWKPR.........
IQG1_YEAST/111-218......LPS.EIE.......LCVGDSLRNGVFLAKLTQRI.NP---................DLTTVIFPA........G
ARHG6_HUMAN/4-111......TIC.DPE.......EFLKSSLKNGVVLCKLINRL.MP---...G............SVEKFCLDP........Q
CNN3_HUMAN/29-130......G.............PNFQLGLKDGIILCELINKL.QP---...G............SVKKV..........NES
Q16SR6_AEDAE/65-210...EYGQRL.QSPTIA.PVRDF..RELCDGVCLAYLISYY.CP---...KL.........V.PWHSV..........KFN
Q19011_CAEEL/279-368....................DV.FELISDKEGLIDRCNAS...---...NI...........NSDSV.............
Q19816_CAEEL/342-462......DQL.TVS.......NF.SSDWTDCRAFCALLYDL.FP---...DT.........MPDVTVSPIVG......DC.
Q23158_CAEEL/153-254.......NV.NVQ.......NF.HNSWKDGLAFCALIHRH.RP---...DL.........L.DYSQL..HK......G..
Q24109_DROME/408-509.......GI.PMY.......EF.SASWISGRALCAIIHSY.LP---...DL.........I.DKTYL.............
MYPH_ECHGR/27-131......D....RS.......KLYEDILKDGTVLCKLMNSI.KP---...G............CIKKI.N........ENA
Q26574_SCHMA/114-231......GIL.PVDPS..VDGQL.YQRCKNGILLCKLVNVA.SP---...NT.........I.DERSINRGP........S
Q26574_SCHMA/262-375......CDR.RIT.......NF.NSDLADSVVYAHLMEQI.VP---...IDKRC...KLMS.ASEIL..SS......T..
Q26574_SCHMA/393-498.......SL.GVKPY...VTHL.YTDLSNGLVLLQLFDKI.KP---...GA.........V.DWSLVDQDF......DPK
Q26574_SCHMA/516-618......RAK.PLS.......SFRDPALATGIPILQLLEHI.KP---...NSTN....KDIW.LGNNI..DD......A..
VAV_CAEEL/40-151......K.N.GTM.......LEFASVLRDGILLCRLANTL.VP---..NGI...........DQKKI..........MRT
Q4RGQ5_TETNG/132-288..REPLSGR.TLQHFP.LLHDL.LRDVSDGMALLAVTHFY.CP---...EL.........V.KLEDI..........CLK
Q4RHF5_TETNG/170-327.RKDKMQSR.HKPVFP.VVNEV..KDLSSGCAIAAVIHYY.CP---...GL.........L.RLEDI..........CMK
Q4RV77_TETNG/184-331...EHGQQR.SAPSLP.LVENL.LKDNTDGCALTTLLHFY.CS---...TV.........I.RLDDI..........CLK
Q4SFF1_TETNG/178-334..KEQASAQ.PVPWIP.PVDNL.LKDSSDGSALAALLHFY.CP---...QL.........L.QLSDV..........CLK
Q4T883_TETNG/176-354YRKDRVQSK.LTPTFP.LVYGV..KDLSNGCAIASVLHYY.CP---...GL.........L.PLEDV..........CLK
PLSL_MOUSE/267-375......C.T.KIT.......NF.STDIKDSKAYYHLLEQV.AP---...KGDEEGIPAVVI.DMSGL..RE......K..
PLSL_MOUSE/518-624......KSS.SIA.......SFKDPKISTSLPVLDLIDAI.QP---...GSIN....YDLL.KTENL..DD......E..
Q66HU6_DANRE/156-312..REHMSGH.PVPHLA.VMEDL.MKDICDGAALLAVIHFY.CP---...EY.........M.RLDDI..........CLK
PLSL_DANRE/516-621......KGT..IS.......GFKDGSISSSMPVLDLIDAI.QP---...GSIR....YDLL.KAEDL..TD......E..
FIMB1_ARATH/126-240......QFL.PLDPH...SNQL.YELVKDGVLLCKLINVA.VP---...GT.........I.DERAINTK.........R
FIMB1_ARATH/271-371......YKK.TVS.......NF.SADLKDAQAYAFLLNVL.AP---...EH.........C.DPATL..DA......K..
MILK1_HUMAN/5-108.......GV.EIR.......DL.SSSFRDGLAFCAILHRH.RP---...DL.........L.DFDSL..SK......D..
MICA1_HUMAN/511-612.......GV.HVS.......DL.SSSWADGLALCALVYRL.QP---...GL.........L.EPSEL..QG......L..
Q90574_CHICK/38-141.......NK.RIG.......NL.QHDLSDGLRLIALLEVL.SQ---...KR.........M.YRKYHQRPT......FR.
Q90574_CHICK/161-261.......YL.PIT.......NF.NQNWQDGKALGALVDSC.AP---...GL.........CPDWETW..DP......S..
Q966J8_CAEEL/168-289......E.D.SNTNIP.EMEDL.YEDISDGQCLCALLHWY.RP---...HE.........M.PVADI..........SFN
CLMN_HUMAN/35-139.......PL.EVK.......DL.FVDIQDGKILMALLEVL.SG---...RN.........L..LHEYKSSS......HR.
CLMN_HUMAN/190-291.......GV.AVQ.......DF.AGSWRSGLAFLAVIKAI.DP---...SL.........V.DMKQA..LE......N..
Q99140_DROME/40-140.......KM.EVE.......DL.FTDLADGIKLLKLLEII.SS---...EK.........L..GKPNSG.R......MR.
Q99140_DROME/161-265.......GV.NIT.......DF.TNSWRSGLGFNALIHSH.RP---...DL.........F.EYSTIVNSK......N..
CNN2_HUMAN/31-132......G.............PDFQKGLKDGTILCTLMNKL.QP---...G............SVPKI..........NRS
GA2L1_HUMAN/30-148..........GGG.......DGFLTGLATGTTLCQHANAV.TE---...AA...........RALAAARPARGVAFQAHS
SMTL1_MOUSE/346-449.......HV.DIQ.......NF.SSSWSSGMAFCALIHKF.FP---...EA.........F.DYAEL..DP......A..
EH1L1_MOUSE/1214-1316.......GV.CIT.......NF.TTSWRNGLAFCAILHRF.YP---...DK.........I.DYFSL..DP......L..
Q9BK91_STRPU/37-138.......SKPPIQ.......DL.YSDLRDGSILLALLEVL.SG---...QK.........L..KRERGF........MR.
Q9BK91_STRPU/155-257.......RV.DVK.......NF.TSSWRDGLAFNAILHRH.RP---...DL.........F.VYHYL..LK......D..
Q9DGM6_DANRE/184-286.......NI.NIT.......NF.TTSWKDGMAFNALIHKH.RP---...DL.........V.DYGNL..KR......S..
PARVA_MOUSE/98-202.......RI.IVK.......DL.AEDLYDGQVLQKLFEKL.ES---...EK.........L.NVAEVTQSE......I..
PARVA_MOUSE/265-369......NL..EVT.......EL.ETQFADGVYLVLLMGLL.EG---...YF.........V.PLHSFFLTP......DS.
PARVB_MOUSE/91-195.......RI.IVK.......QL.EEDLYDGQVLQKLLEKL.AH---...CK.........L.NVAEVTQSE......I..
FIMB3_ARATH/396-499.......SL.GIESY...VNNV.FEDVRNGWILLEVVDKV.YP---...GS.........V.NWKQASKPP......IKM
FIMB2_ARATH/125-239......SYL.PIDPA...TNAF.FDLVKDGVLLCKLINVA.VP---...GT.........I.DERAINTK.........K
FIMB2_ARATH/270-370......YEK.QVT.......NF.SSDLKDGEAYAYLLNAL.AP---...EH.........S.THVAL..ET......K..
FIMB2_ARATH/516-621......RTS.QAD.......SFRDKNLSSGMFFLELLSAV.EP---...RVVN....WSLV..TNGE..TE......E..
Q9GQV2_DROME/18-120.......DR.SIN.......NL.ETDLSDGLRLIALIEVL.SQ---...KR.........M..PKYNKRPT......FR.
Q9GQV2_DROME/142-242.......DL.PIN.......NF.TNDWTTGKAVGALVDAC.AP---...GL.........CPDWELW..DP......K..
SPTN4_HUMAN/183-285.......EV.NIQ.......NF.TTSWRDGLAFNALIHRH.RP---...DL.........V.DFSKL..TK......S..
PARVG_HUMAN/47-151.......HI.VVR.......SL.EEDMFDGLILHHLFQRL.AA---...LK.........L.EAEDIALTA......T..
Q9I7J0_DROME/9-111..........VPS.......GQYEDILKDGIWLCKLANKL.AP---...G............SVKKI..........QER
ANC1_CAEEL/26-130......G...RIE.......DL.FEDIRDGVLLCHLIEVL.TG---...EA.........L..AVHKGRVS......KR.
ANC1_CAEEL/225-328......GGR.RVE.......NM.DKQWRDGILFCALVSRW.RP---...DV.........I.SMREV..TN......A..
VAV_DROME/21-137......QPD.AEI.......RILAMTLRDGVLLCNLVIHL.DP---..SSL...........DPREF..........NRK
SPTN5_HUMAN/57-159.......GI.KIR.......NL.YTELADGIHLLRLLELI.SG---...EA.........L..PPPSRG.R......LR.
SPTN5_HUMAN/180-282.......NV.NIT.......DF.SRSWSDGLGFNALIHAH.RP---...DL.........L.DYGSL..RP......D..
CAMP3_HUMAN/166-315..KDRVVAR.RAPCFP.TVTSL..QDLASGAALAATIHCY.CP---...QL.........L.RLEEV..........CLK
Q9SJ84_ARATH/391-494.......SL.GAVTY...VDNV.FEDVRNGWVLLEVLDKV.SP---...GS.........V.NWKHANKPP......IKM
Q9SS42_ARATH/22-140......PNQ.PSE.......KEFISCLRNGMILCNAINKI.HP---...G............AVSKVVE..NYSYLNGEY
DMD_CAEEL/132-234.......EI.DVY.......DF.TSSFRDGHAFNYLIHSY.DR---...KL.........I.NLTKT..AE......M..
Q9TYW4_CAEEL/29-132.......GE.TIE.......SL.ETDFSDGLKLIALAQVL.SH---...KN.........V..GKFNKKVA......FR.
Q9TYW4_CAEEL/153-253.......GM.PIS.......NF.TSDWNDGVALGALVNSM.AP---...GA.........LEDWENW..SP......N..
Q9U3Z8_ENTHI/13-114.......EDQQIK.......NL.LTDLSESDILISLMEKL.SG---...KK.........A.YPHKKCMTK......SR.
Q9U3Z8_ENTHI/132-229.......GL.NVS.......NF.SSDWKDGVALVKLTEAV.SA---...GQ.........I.KFEQF.............
Q9U5G9_TETTH/87-200......ELL.PIDPQ...SNKI.FEAVGDGVLLCKLINKA.TP---...GT.........I.DPRAINT..........K
Q9U5G9_TETTH/231-330......HST.KIN.......NF.SKDVSSGTEYTVLLNQI.AP---...EK.........C.NKDGL..NL......E..
Q9U5G9_TETTH/358-460.......SL.NIEDV..YLNNM.IQDLRDGIVLCKIMDKL.AP---...GK.........V.DLKKVSNKN......SK.
Q9U5G9_TETTH/469-571.......DK.HIT.......GFKDKSLKNSHFFFKIMESI.EP---...RAIN....QDLI..TPGE..TD......E..
TAGL3_HUMAN/27-137......HPP.PGR.......AHFQKWLMDGTVLCKLINSL.YP---PGQE............PIPKI..........SES
VAV3_HUMAN/4-120......WDS.AQV.......FDLAQTLRDGVLLCQLLNNL.RA---..HSI...........NLKEI..........NLR
MARE3_HUMAN/17-116.......HL.NYT.......KI..EQLCSGAAYCQFMDML.FP---...GC.........V.HLRKVKFQA......KL.
Q9VU34_DROME/13-116.......GV.KVE.......NM.TTSWRNGLAFCAIIHHF.RP---...DL.........I.DFDRL..KA......D..
Q9VWD0_DROME/93-197.......RI.IVQ.......HL.EEDMYDGQVLHKLWEKL.TG---...KK.........L.DVPEVTQSE......Q..
Q9VWD0_DROME/260-364......NF..EIS.......DL.NTDFRDGVYLCLLMGLL.GG---...FF.........V.PLHEFHLTP......QD.
Q9VZI1_DROME/28-134......NTS.GDT.......DNFFEVLKDGVILCKLANAL.QP---...G............SIKKI..........NES
Q9W2W2_DROME/21-120.......QC.NLI.......NI..EQLCTGAAYCNLMHML.YP---...KL.........I.NLKRVKFFS......NQ.
Q9XXA2_CAEEL/17-115.......KS.HFT.......KV..EEMASGAAYCQLTHLL.FN---...AI...........NLKKVKFNP......RS.
Q9XZ57_DROME/17-116.......QS.QFS.......KI..EELCTGAAYCQFMDML.FP---...NS.........V.PVKRVKFRT......NL.
Q9XZE9_HYDVU/33-146........V.PPT.......TELEQGLTNGVILAKLAHFF.AP---...NV...........VPLRKIFDKDLTRYKERG
Q9YGW4_CHICK/40-143.......NK.SIS.......DL.QRDLGDGLRLIALLEVL.SQ---...KK.........M.GRKHHPRPN......FR.
Q9YGW4_CHICK/162-262.......QL.RIT.......NF.NRDWNDGRALGALVDNC.AP---...GL.........CPDWQSW..DP......A..

PF06294

SPEF2_MOUSE/5-158----------SPK-------SF-AKAFSNGYLIGEVLFKF-ELQS.DFAEFSESRGSTAKLNNFSRL.QPTLHLLGLQFD
SPEF2_HUMAN/5-153----------SPK-------SF-AKAFSSGYLLGEVLHKF-ELQD.DFSEFLDSRVSSAKLNNFSRL.EPTLNLLGVQFD
SPAT4_MOUSE/54-210----------FPR-------NV-TRDFSNGYLVAEIFCIY-YPWDLRLSSFENGTSLKVKLDNWAQI.EKFLAKKKFKLP
SPEF1_MOUSE/13-164----------PKR-------NL-SRDFSDGVLVAELIKFY-FPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVP
Q9VXK2_DROME/17-174----------STQ-------RL-RREFSDVLPLAEIFKRD-YPRLVDLFNYPKKSSVQLKLANWETFNFKVLSKLNMTLT
Q9VT31_DROME/9-158----------LDL-------KA-RRSFSDVLPVAKIVKRS-HPRLVDLHNYTPKSSVALKLQSWQTFNQKVLKKLGINLT

PF06395

A5DJC8_PICGU/101-185--------------------------FQLGAPLCLLFNAV-AP-----------------.-.EHPIAV..------...
Q0UQ03_PHANO/151-242--------------------------FRRGYPLMELYNAL-EP-----------------.-.RTLLSIPN------S..
Q6BPP7_DEBHA/160-246--------------------------FQQGSSLCALFNCV-VS-----------------.-.DYSIPI..------...
A7TRQ3_VANPO/182-268--------------------------FQQGSPLCIIFNSV-QN-----------------.-.QVKLPV..------...
A5E275_LODEL/193-281--------------------------FQQGSPLCLIFNHV-MT-----------------N-KEQQLTI..------...
A2QIY3_ASPNC/61-149--------------------------LRTGYPLLTIYNAS-DP-----------------.-.EEFLEIDT------...
Q6CBW7_YARLI/151-244--------------------------FRLGAPLCILFNML-QP-----------------.-.RTPLTVDP------HAA
A3LZC0_PICST/155-241--------------------------FQQGAPLCLAFNAV-VP-----------------.-.GYQIPV..------...
Q4PBU1_USTMA/157-246--------------------------FRLGSPLCALFNTM-SP-----------------.-.DVELPVNP------...
A7EK75_SCLS1/142-230--------------------------LRKGTPLVTLYNTL-KP-----------------.-.AEPLPLPD------...
Q6FIT2_CANGA/203-289--------------------------FQQGSPLCVLFNAV-KP-----------------.-.QHKLAV..------...
Q7S4Y3_NEUCR/92-181--------------------------LRTGLPLLTIYNAL-QP-----------------.-.EKPLHVDQ------...
Q0MQZ9_PENMA/62-150--------------------------LRAGYPLITIFNAS-QP-----------------.-.DEMLEVDP------...
Q59YK6_CANAL/166-252--------------------------FQQGAPFCVLINHI-LP-----------------.-.DSQIPV..------...
Q9HF59_ASHGS/151-237--------------------------FQQGSPLCIIFNAV-KP-----------------.-.HCKLPV..------...
Q2GPG0_CHAGB/100-189--------------------------LRTGYPLLAIYNVL-QP-----------------.-.ETPLQVQA------...
SCD1_SCHPO/105-194--------------------------CRLGYPLCALFNCL-PV-----------------.-.KQKLEVNS------...

PF11971

VAV3_MOUSE/18-103----QMSQFLCLKNIRTFLA---ACC------DTFGMRKSE-------LFEAFDLF------------------------
CAMP1_HUMAN/229-312----VTSMADSLYNIRLLRE---FSN------EYL.NKCFY-------L.TLEDML------------------------
VAV2_MOUSE/18-103----QMSQFLCLKNIRTFLK---VCH------DKFGLRNSE-------LFDPFDLF------------------------
Q4SMI8_TETNG/46-131----QMSQFLCLKNIRTFLA---ACQ------TKFYLKKSE-------LFEAFDLF------------------------
Q1MTA1_DANRE/54-131----SLDEKDVEKNNQLAFD---VAE------REFGISPIM-------..TGKEMS------------------------
Q5C317_SCHJA/159-236----QLSARDPIKNLNLAFD---VAE------KHL.DIPKM-------L.DPEDMV------------------------
CAM1B_DANRE/244-327----VTSIADSLYNIQLLKE---FAN------EYL.NKSFY-------L.TLEDLL------------------------
Q4RGQ5_TETNG/186-269----VPSIADSVYNIQLLKE---FSN------EYL.NKCFH-------L.KPEDML------------------------
Q66HU6_DANRE/210-293----VPSLSDSVYNIHLLRE---FSN------EYL.NRCFY-------L.HTEDLL------------------------
A4IIC9_XENTR/222-304----TMSVADSLYNLQLLRE---FYA------QHL.PPSCP-------L.SLEDLL------------------------
CAMP3_MOUSE/214-296----PMSVADSLYNLQLVQD---FCA------SHL.PRGCP-------L.SLEDLL------------------------
Q4T883_TETNG/253-335----TMSVADSVYNLQLIRE---FCQ------SSL.QGCCP-------L.AVEDLL------------------------
Q1LUF1_DANRE/220-301----TMSLADSLYNLQLIQD---FCR------EQL.NHCCH-------F.SLEDML------------------------
Q4RV77_TETNG/229-312----TMSLADSLYNLQLVQE---FCK------NNL.NHCCH-------F.TLEDML------------------------
Q4SFF1_TETNG/232-315----TMTLADRLYNLQLIQE---FCK------DNL.NDCCH-------F.TLEDML------------------------
A8XND4_CAEBR/147-231----AATTRDCQYNLMLLQQ---FCH------HHLANDPFH-------F.EIEDLL------------------------
A7RQ88_NEMVE/232-316----ELSTDHMVHNVELFRS---RCS------QHICTSVLA-------L.TLEDIL------------------------
SSP4_DROME/189-272----LPAVEDSIHNILLVCN---FSQ------KHLPYTVMH-------M.TPEDVT------------------------
Q16SR6_AEDAE/108-191----VPTIEDSIHNILIVSN---FSE------RSLPYSVFH-------M.TPEDIT------------------------
A0DC81_PARTE/15-97----ANSTQTKQYNWSTLNT---KVL------KKLGFQLAQ-------K.DIDSVI------------------------
Q22DM0_TETTS/15-97----AHSVTQKLYNWNTLNQ---RVL------KKMGFQISK-------N.DIDCII------------------------
Q4DT05_TRYCC/14-96----SMSMKLKRDNWETLNN---RVF------RKLHFEVPP-------E.EINDIT------------------------
Q52WZ6_TRYBR/14-96----AMSQSKKIENWNTLNN---RVF------RKLHFEVAR-------D.EISDIT------------------------
A7S652_NEMVE/9-90----GASLATKMGNWSQLQT---FFQ------RQ.GFGIPK-------E.VIDGTI------------------------
B1ARM8_MOUSE/1087-1159----SQSVACAQTGSVVLNS---S..------.........-------..SESEGG------------------------
Q4S6P6_TETNG/521-596----TQTVECSLRGRVELDC---STN------E........-------..SDNSFD------------------------
A7RIX2_NEMVE/866-936----TLT.....RNPGVLDS---SDS------E........-------..EDEGIL------------------------

PF00307

SMTN_HUMAN/802-906.........NRRQNFEVAFS...SAE------M.LVDCVPL.......V-EVDDMMIM.GKKPDPK.......CVFTYVQ
O44788_CAEEL/27-138K.....MAFPMMENISNFLA...AAK------Q.FGVMEISC......F-QTVDLYE....NKQCY.......KVIECLR
PARVG_MOUSE/213-317P....SSPTEMLHNVTLALD...LLK------DEGLFSYPV........-NPEDIV.....NKDAK.......STLRILY
CAMP2_HUMAN/178-335ET...MSLADSLYNLQLIQE...FCQ------EYLNQCCHF........-TLEDMLYA..ASSIKS.......NYLVFMA
SPTN2_HUMAN/60-161........IHCLENVDKALQ...FLK------E.QKVHLEN.......M-GSHDIV.....DGNHR.......LTLGLVW
SPTN2_HUMAN/179-281.........NAHYNLQNAFN...LAE------KELGLTKLL........-DPEDVNV...DQPDEK.......SIITYVA
MICA3_HUMAN/521-624.........NVEKNNQLAFD...IAE------KELGISPIM........-TGKEMASV..GEPDKL.......SMVMYLT
Q9W204_DROME/174-274.........QSVRNCTQAMD...LAQ------REFGVPKVL........-EPEYLAS...PWLDEL.......SGMTYLS
Q9W204_DROME/277-376.......PFHYENNIRKAVD...AGA------R.LGVQPIL........-TAKDMAN...PEVEHL.......GIMAYAA
SSP4_DROME/159-291P.....AVEDSIHNILLVCN...FSQ------KHLPYTVMH.......M-TPEDVTYM..RGSMKL.......NLVVLLT
VAV2_HUMAN/4-120.......QFLCLKNIRTFLK...VCH------DKFGLRNSEL......F-DPFDLFD....VRDFG.......KVISAVS
FIMB_DICDI/119-232......NAFRINENQVLCIN...SAK------A.IGCNVVN.......I-GAGDLV.....EGRAH.......LIMGLTW
FIMB_DICDI/263-365.........NLDQRAVKVLE...NAD------K.LGCKKFL........-KPKDIV.....TGFQK.......LNLAFVA
FIMB_DICDI/382-488M....GAEMKKIENCNYAIQ...LGK------D.CKYSLVG.......I-DGKNVY.....DKNKT.......LTLSILW
FIMB_DICDI/504-608........EDNLLNAKLAVS...TAR------K.VGAVVFA........-LPEDIV.....EVKPK.......MVLTLFA
PLSI_HUMAN/269-376.........NDLKRAGLMLQ...EAD------K.LGCKQFV........-TPADVV.....SGNPK.......LNLAFVA
Q18109_CAEEL/17-118........IQKLMNVQMALD...ALR------E.DGVKTVN.......I-GSHDIV.....DGNEK.......LILGLIW
Q18109_CAEEL/128-228.........EARENCHRALL...LAE------RYLEVPPII........-SSDHLSS...PHLDEL.......SCLTYLS
Q18109_CAEEL/231-332........NDFVENVAIVLD...AAA------D.IGVGSLI........-GADDIAE...PQGEHL.......GTMALVA
PLST_RAT/126-239......TPFIIQENLNLALN...SAS------A.IGCHVVN.......I-GAEDLR.....AGKPH.......LVLGLLW
PLST_RAT/270-378.........DDLKRAESMLQ...QAD------K.LGCRQFV........-TPADVV.....SGNPK.......LNLAFVA
PLST_RAT/400-506PYPKLGANMKKLENCNYAVE...LGK------NQAKFSLVG.......I-GGQDLN.....DGNPT.......LTLAVVW
PLST_RAT/521-627.......EEDKHNNAKYAVS...MAR------R.IGARVYA........-LPEDLV.....EVKPK.......MVMTVFA
EHBP1_HUMAN/446-548.........DIKENNKKAYD...GFA------S.IGISRLL........-EPSDMVLL..AIPDKL.......TVMTYLY
DMDA_DROME/15-116........VHHINNLNKVIT...EIQ------Q.HGVKLVN.......I-SSDDIV.....GGNAK.......LTLGLIW
DMDA_DROME/130-230.........HALKRLHLAFD...LAH------RHFKIEKLL........-DAEDVHT...HKPDNK.......SIQMYVM
A2AHC4_MOUSE/185-350EV...PSMADSLYNIRLLRE...FSN------EHLNKCFYL........-TLEDMLYA..PLVLKP.......NVMVFIA
A4IIC9_XENTR/151-323DT...MSVADSLYNLQLLRE...FYA------QHLPPSCPL........-SLEDLLYV..PSALKV.......NLVALLA
CAM1B_DANRE/190-346EV...TSIADSLYNIQLLKE...FAN------EYLNKSFYL........-TLEDLLYA..PPVLKH.......NVMVFIA
A7RQ88_NEMVE/187-335RE...LSTDHMVHNVELFRS...RCS------QHICTSVLA.......L-TLEDILYA..SQAMKP.......NLIALLA
O01542_CAEEL/27-133I.....STFACMENINAFVE...FAK------K.QGVPNEET......F-QSVELVE....GRDLF.......SVCVTLL
O08614_MOUSE/34-135........VHALNNVNRVLQ...VLH------Q.NNVDLVN.......I-GGTDIV.....AGNPK.......LTLGLLW
O08614_MOUSE/153-255.........SPIERLDHAFD...KAH------TSLGIEKLL........-SPETV.AV..HLPDKK.......SIIMYLT
AIN1_SCHPO/11-114........VHRLENVNKALE...YIK------S.KGMPLTN.......I-GPADIV.....DGNLK.......LILGLIW
AIN1_SCHPO/126-230.........NHRANMQLAFD...IAQ------KSIGIPRLI........-EVEDVCDV..DRPDER.......SIMTYVA
STG1_SCHPO/6-109N.....MPFVQMENISAFIN...YAQ------QVVHVPSQDM......F-QTSDLFE....RRNDE.......QVLRSIH
RNG2_SCHPO/44-148......LQFRHSDNINKFLD...FIH------G.IGLPEIFH......F-ELTDIYE....GKNLP.......KVIYCIH
CTXA_DICDI/11-115........INMIQNVALALK...FLD------EELKIKVQG.......I-GSEDFV.....DNNKK.......MILGFLW
CTXA_DICDI/127-229.........DPIARLNAAFD...FAE------KGLGVPKLL........-EAEEV.MR..GTTDER.......SLVLYTS
CTXB_DICDI/12-117........IMRVQNLHLAML...FID------EDLKIKVQG.......V-AAEEFV.....DNNKK.......MILGFLW
CTXB_DICDI/129-231.........DNIARLNAAFD...FAE------KGLGIPKLL........-EAESL.SK..GNVDER.......SIVLYTS
PARV_CAEEL/102-206.........GQRQKLQIVVQ...TAN------RILGQPREQ........-EKWSADLI..HQKDFT.......AIIQLLV
PARV_CAEEL/269-373.......HEEKVKNVQFAFK...LME------D.TGLEKPR.......S-RVQDIA.....NGDVK.......STLRLLH
O17509_BOTSH/17-116........EHEYISNFKILQ...ECF------KRVSVDKNV........-PVERLV.....KGRFQ.......DNFEFVQ
O17666_CAEEL/339-437........IRKIGNVKIVLQ...EMS------S.LGVPTDN.......V-NAESIV.....GGKKD.......EILSILW
O17772_CAEEL/48-163A....TPVYRHSDNIMQWRR...AME------S.VRLPEIFI......P-ETADVFE....GRNM........KTVFCLF
O22260_ARATH/47-166AP...LSAFQYFENVRNFLV...AIQ------E.MGFPT.........F-EASDLEQ....GGNAS.......RVVNCVL
O24399_WHEAT/87-187.........NPDERAKMVLE....QA------EKLDCKRYL........-TPKDIT.....EGSAN.......LNLAFVA
O24399_WHEAT/213-316.......PFRKLENCNQVVK...IGK------EL.KFSLVN.......L-AGNDIV.....QGNKK.......LIVALLW
O24399_WHEAT/337-442.........EKKLNATYIIS....VA------RKLGCSVFL........-LPEDII.....EVNQK.......MILTLTA
GAS2_HUMAN/37-157AP...SGSFFARDNTANFLS...WCR------D.LGVDETCL......F-ESEGLVL....HKQPR.......EVCLCLL
O44727_CAEEL/30-136I.....SNFNCLENINQFST...AAR------S.LGVKDEET......F-QSVDLFD....GRDLF.......SVTVTLQ
O49971_ARATH/74-174.........SSFERAKLVLE....HA------DKMGCRRYL........-TAKDIV.....EGSPN.......LNLAFVA
O49971_ARATH/199-302.......PFKKVENCNQVVK...LGK------QL.KFSLVN.......I-AGNDIV.....QGNKK.......LILAYLW
O49971_ARATH/320-425.........EKKMNATYVIS....IA------RKLGCSIFL........-LPEDII.....EVNQK.......MMLTLTA
O50064_ARATH/127-241M....LNPWERNENHTLCLN...SAK------AI.GCTVVN.......I-GTQDII.....EGRRH.......LVLGVIS
FIMB_SCHPO/115-233KP...LDNFKCIENNNVVIN...SAK------AMGGISITN.......I-GAGDIL.....EGREH.......LILGLVW
FIMB_SCHPO/388-495DE...MMRFKAVENCNYAVD...LGK------NQ.GFSLVG.......I-QGADIT.....DGSRT.......LTLALVW
O61604_DROME/128-241N....LTVYREFENLTLALV...SSQ------AI.GCNIVN.......I-DAHDLA.....KGKPH.......LVLGLLW
O61604_DROME/272-374.........DLQSRAEIMLQ....QA------AKLNCRSFL........-TPQDVV.....NGVYK.......LNLAFVA
O61604_DROME/394-499R.....KFMEKLENCNYAVD...LGK------QL.KFSLVG.......I-AGQDLN.....DGNAT.......LTLALIW
O61604_DROME/515-620.........DNLANAKYAIS....MA------RKIGARVYA........-LPEDIT.....EVKPK.......MVMTVFA
LRCH4_HUMAN/537-647PK...LSALKARKNVESFLE...ACR------K.MGVPEADL......C-SPSDLL.....QGTAR.......GLRTALE
ACTNB_DICDI/25-128........LHYINNLNFSLK...FIG------D.EGLRLVG.......V-ASEDIT.....DGNLK.......LILGLVW
ACTNB_DICDI/149-249.........DSLGNLTLAFE...VAN------KELGIPSIL........-DPHDIIT....TPDEL.......SILTYIS
O77291_DROME/151-251........FHMLQNAQMALD...FLR------Y.KKIKLVN.......I-RAEDIV.....DGNPK.......LTLGLIW
O77291_DROME/266-368.........RPRERLETAFH...IVE------KEYGVTRLL........-DPEDV.DT..NEPDEK.......SLITYIS
O80491_ARATH/57-176AA...LSAFQYFENLRNFLV...FVE------E.MGIPT.........F-EVSDFEK....GGKSA.......RIVECVL
ATK4_ARATH/47-163AA...LSAFQYFENIRNFLV...AIE------E.MGLPS.........F-EASDMEK....GGKSI.......RIVNCIL
O93547_XENLA/30-131R.....QNWHQLENLSNFIK...AMS------L.YGMKSVDL......F-EANDLFE....NGNMT.......QVQVSLL
O93981_GIBPU/51-169KN...LNAFHMSENNNIVIE...SAK------GI.GCSVVN.......I-GAGDII.....EVREH.......LILGLIW
O93981_GIBPU/200-301.........DLHDRAEAVLQ....EA------DKLGCRKFL........-TPKSLV.....AGNPK.......LNLAFVA
O93981_GIBPU/325-432GE...MSRFKAVENTNYAIE...LGK------QN.GFSLVG.......I-QGADIT.....DGQRT.......LTLGLVW
O93981_GIBPU/450-555.........DAYLNAKLSIS....IA------RKLGATIWL........-VPEDIC.....QVRSR.......LITTFIG
MICA2_HUMAN/519-622.........DAVENNQLAFD...VAE------REFGIPPVT........-TGKEMASA..QEPDKL.......SMVMYLS
O96524_TRIVA/18-122........VQKRENVDLALK...YIN------EVKKIRTVG.......I-GADDII.....NKNLK.......LTLGLTW
O96524_TRIVA/134-235.........DHKGACEKAFA....AC------KELGIYVYL........-DPEDVID...TTPDEK.......SVVTQVA
O97251_PLAF7/21-120........EYECIINYKLIQ...SVF------NKLGIKKYM........-DVDKLI.....KGKYQ.......DNFEFLQ
ACTN1_CHICK/148-251.........DPLTNLNTAFD...VAE------KYLDIPKML........-DAEDIVGT..ARPDEK.......AIMTYVS
ACTNA_DICDI/25-127........IHNIQNVGLCLK...HIE------S.HGVKLVG.......I-GAEELV.....DKNLK.......MTLGMIW
ACTNA_DICDI/139-242.........DKAGNLQLAFD...IAE------KELDIPKML........-DVSDMLDV..VRPDER.......SVMTYVA
ACTN1_HUMAN/34-135........VHKISNVNKALD...FIA------S.KGVKLVS.......I-GAEEIV.....DGNVK.......MTLGMIW
GELA_DICDI/15-117........MQKIENNNMAVN...FIK------S.EGLKLVG.......I-GAEDIV.....DSQLK.......LILGLIW
GELA_DICDI/128-227.........DAVQDIDRSMD...IAL------EEYEIPKIM........-DANDMNS....LPDEL.......SVITYVS
MP20_DROME/20-123G.....GQFKFMENINNFQK...ALK------E.YGVPDIDV......F-QTVDLYE....KKDIA.......NVTNTIF
VAV_HUMAN/4-120PQ...MSQFLCLKNIRTFLS...TCC------EKFGLKRSEL......F-EAFDLFD....VQDFG.......KVIYTLS
ACTN_DROME/150-253.........NPLENLNTAFD...VAE------KYLDIPRML........-DPDDLINT..PKPDER.......AIMTYVS
PLSI_CHICK/125-238K....LTPFTISENLNLALN...SAS------AI.GCTVVN.......I-GSQDLQ.....EGKPH.......LVLGLLW
PLSI_CHICK/269-377.........NDLRRAECMLQ....QA------DKLGCRQFV........-TPADVV.....AGNPK.......LNLAFVA
PLSI_CHICK/399-505L....GGNMKKIENCNYAVE...LGK------TKAKFSLVG.......I-AGHDLN.....EGNPT.......LTLALIW
PLSI_CHICK/520-626.........DKLNNAKYAIS....VA------RKIGARIYA........-LPDDLV.....EVKPK.......MVMTVFA
TAGL_CHICK/27-138PP...TMVFKQMEQIAQFLK...AAE------D.YGVVKTDM......F-QTVDLFE....AKDMA.......AVQRTLV
CNN1_CHICK/31-132V.....QNWHKLENIGNFLR...AIK------H.YGVKPHDI......F-EANDLFE....NTNHT.......QVQSTLI
PLEC_RAT/304-406.........TNLENLDQAFS...VAE------RDLGVTRLL........-DPEDV.DV..PQPDEK.......SIITYVS
FIMB_YEAST/142-259KE...LNNFQASENANIVIN...SAK------AI.GCVVVN.......V-HSEDII.....EGREH.......LILGLIW
FIMB_YEAST/290-390.........DLMERAEQVLQ....NA------EKLDCRKYL........-TPSSLV.....AGNPK.......LNLAFVA
FIMB_YEAST/414-521AE...ISRFKALENTNYAVD...LGR------AK.GFSLVG.......I-EGSDIV.....DGNKL.......LTLGLVW
FIMB_YEAST/537-642.........ERYANARLAIS....IA------RKLGALIWL........-VPEDIN.....EVRAR.......LIITFIA
TAGL2_HUMAN/27-137T.....MAFKQMEQISQFLQ...AAE------R.YGINTTDI......F-QTVDLWE....GKNMA.......CVQRTLM
BIM1_YEAST/9-107........EYEFQTNYKILQ...SCF------SRHGIEKTV........-YVDKLI.....RCKFQ.......DNLEFLQ
LRCH1_FELCA/134-245PK...LSMAKCRRNVENFLE...ACR------K.LGVPEEKL......C-LPHHILE....EKGLV.......KVGITVQ
IQGA1_HUMAN/47-160......LHFRHTDNVIQWLN...AMD------E.IGLPKIFY......P-ETTDIYD....RKNMP.......RCIYCIH
P90545_ENTHI/11-113........VAKLENTEQALN...FIK------A.DGVKLVN.......I-DAQNIV.....DGNLT.......LILGLLW
P90545_ENTHI/123-223.........EGEERIQYGLS...IAE------DKMEIPAII........-AAEDMAL...PEPDEL.......SVMAYVS
P91888_SCHMA/27-143TM...TAPLNRWKIIQTFLN...AAV------A.YGVPRASL......F-QTVDLYE....LRNMP.......QVLNTLL
SPTCB_DROME/172-274.........NAIHNLNNAFD...VAE------DKLGLAKLL........-DAEDV.FV..EHPDEK.......SIITYVV
Q03486_PHYPO/10-112........IHKINNVFLAMQ...FLE------Q.MEVKVEG.......V-AAEDFV.....DSNKK.......LILGFLW
Q03486_PHYPO/124-226.........SPDQRLEKAFE...IAE------KTINIPKLL........-DVNEV.MK..GTADER.......ALILYTS
SCP1_YEAST/29-137SS...KMPFVQMDQISQFLS...FSR------K.YGVPEDEL......F-QTIDLFE....KKDPA.......IVFQTLK
MAL3_SCHPO/5-103........EYQYINNWKVLQ...QVF------LKKGIDKVV........-DPERLS.....RCKMQ.......DNLEFVQ
YBX7_SCHPO/67-171........YQISERNTVYLNAFFHFL------DFIGMFTPFR......F-ETKDLVR....RFNIP.......KVIYCLH
IQG1_YEAST/111-218D....KLQFKHTQNINAFFG...LVE------H.VGVPDSFR......F-ELQDLYN....KKNIP.......QVFETLH
ARHG6_HUMAN/4-111......TEADCINNINDFLK...GCA------T....LQVEI......F-DPDDLYS....GVNFS.......KVLSTLL
CNN3_HUMAN/29-130S.....LNWPQLENIGNFIK...AIQ------A.YGMKPHDI......F-EANDLFE....NGNMT.......QVQTTLV
Q16SR6_AEDAE/65-210HV...PTIEDSIHNILIVSN...FSE------RSLPYSVFH.......M-TPEDITYM..RGAMKQ.......NLVVLLA
Q19011_CAEEL/279-368.........SNTERLNIALA...AAD------AEFGAGRLL........-DAEDVDTN..NNPDEK.......SIITYVS
Q19816_CAEEL/342-462........ISRCRRTFQLLEI.PFDE------RALGISSPTADSGADED-SSSACSVI.TGLTDWR.......YIMNTVF
Q23158_CAEEL/153-254.........DPIHNLNLAFD...IAE------KHLDIPKML........-DAEDV..S..RHPDEK.......STMTYVS
Q24109_DROME/408-509..........AKKKPEEVLAYGIKVA------KSIGVSD..........-SVDLIRELRQGRPNLE.......KIVDFVE
MYPH_ECHGR/27-131T.....MPFKIMENISAFLE...AMK------G.YGVPVADL......F-QTVDLFE....KKDIA.......QVTRTLF
Q26574_SCHMA/114-231L....KNVFNVHENLTLAVN...SAA------SI.GCCVVN.......T-GPRRYY.....AGKRH.......IVLGLIW
Q26574_SCHMA/262-375.........SRQERAMNVLN....NN------ETLGTPFTL........-APEDIY.....LAGEKNNDNRDRLNLAFLA
Q26574_SCHMA/393-498R.....RLFQETGNCNLVID...SAQ------SM.NIRFVN.......V-SGKDIQ.....KRDRK.......LVLGVCF
Q26574_SCHMA/516-618.........SIR...QYAIS....CC------HKAGARVFT........-LPEHLE.....ELNGK.......MILTLFA
VAV_CAEEL/40-151NQ...PSPFLCCNNINYFAM...FCK------TYFNLEDADL......F-TAEDLYY....MNGFQ.......KVLKTLS
Q4RGQ5_TETNG/132-288EV...PSIADSVYNIQLLKE...FSN------EYLNKCFHL........-KPEDMLYS..PPVLKN.......NLMVFIA
Q4RHF5_TETNG/170-327ES...MPVADSLYNLQFIRE...FCD------SCLKSCCHL........-ALEDMLYI..PQELKI.......NLLSFLA
Q4RV77_TETNG/184-331ET...MSLADSLYNLQLVQE...FCK------NNLNHCCHF........-TLEDMLYA..HASIKS.......NYLVFMA
Q4SFF1_TETNG/178-334ET...MTLADRLYNLQLIQE...FCK------DNLNDCCHF........-TLEDMLYA..SSTIKN.......NYLVFMA
Q4T883_TETNG/176-354DT...MSVADSVYNLQLIRE...FCQ------SSLQGCCPL........-AVEDLLYA..PPPLHV.......SALACHA
PLSL_MOUSE/267-375.........DDIQRAECMLQ....QA------ERLGCRQFV........-TATDVV.....RGNPK.......LNLAFIA
PLSL_MOUSE/518-624.........EKLNNAKYAIS....MA------RKIGARVYA........-LPEDLV.....EVNPK.......MVMTVFA
Q66HU6_DANRE/156-312EV...PSLSDSVYNIHLLRE...FSN------EYLNRCFYL........-HTEDLLYG..PPVLKN.......NVMVFIA
PLSL_DANRE/516-621.........KKLNNAKYAIS....MA------RKIGARVYA........-LPEDLV.....EVKPK.......MVMTVFA
FIMB1_ARATH/126-240V....LNPWERNENHTLCLN...SAK------AV.GCSVVN.......I-GTQDLA.....EGRPH.......LVLGLIS
FIMB1_ARATH/271-371.........DPLERAELVLS....HA------ERMNCKRYL........-TAEEIV.....EGSST.......LNLAFVA
MILK1_HUMAN/5-108.........NVFENNRLAFE...VAE------KELGIPALL........-DPNDMVSM..SVPDCL.......SIMTYVS
MICA1_HUMAN/511-612.........GALEATAWALK...VAE------NELGITPVV........-SAQAVVA....GSDPL.......GLIAYLS
Q90574_CHICK/38-141........QMQLENVSVALE...FWS------G.RASSWLS.......I-DSKAIV.....DGNLK.......LILGLIW
Q90574_CHICK/161-261.........KPVDNAREAMQ...QAD------DWLGVPQLL........-PPEEIIH...PDVDEH.......SVMTYLY
Q966J8_CAEEL/168-289DS...ATTRDCQYNLMLLQL...FCR------HHLAVDPFH.......F-EIEDLLYL..RDSLQM.......NVNAFLA
CLMN_HUMAN/35-139........IFRLNNIAKALK...FLE------D.SNVKLVS.......I-DAAEIA.....DGNPS.......LVLGLIW
CLMN_HUMAN/190-291.........STRENLEKAFS...IAQ------DALHIPRLL........-EPEDI.MV..DTPDEQ.......SIMTYVA
Q99140_DROME/40-140........VHKIENVNKSLA...FLH------T..KVRLES.......I-GAEDIV.....DGNPR.......LILGLIW
Q99140_DROME/161-265.........SNLDNLNHAFD...TAA------NELGIPSLL........-DAEDI.DS..ARPDEK.......SILTYVA
CNN2_HUMAN/31-132M.....QNWHQLENLSNFIK...AMV------S.YGMNPVDL......F-EANDLFE....SGNMT.......QVQVSLL
GA2L1_HUMAN/30-148VV...PGSFMARDNVATFIG...WCR------VELGVPEVLM......F-ETEDLVL....RKNEK.......SVVLCLL
SMTL1_MOUSE/346-449.........KRRHNFTLAFS...TAE------KLADCAQLL........-EVDDMVRL..AVPDSK.......CVYTYIQ
EH1L1_MOUSE/1214-1316.........NIKQNNKQAFD....GF------AALGVSRLL........-EPADMVLL..SVPDKL.......IVMTYLC
Q9BK91_STRPU/37-138........VHQLNNVNRALQ...VLH------Q.NKVRLVN.......I-TSNDIV.....DGNSK.......LTLGLVW
Q9BK91_STRPU/155-257.........EPEARLEHAFT...VAH------SHFNIDRLL........-DPEDI.NV..GQPDKK.......SVLMYVT
Q9DGM6_DANRE/184-286.........NPTHNLQQAFN...VAE------KKLGVTKLL........-DPEDV.FT..ENPDEK.......SIITYVV
PARVA_MOUSE/98-202.........AQKQKLQTVLE...KIN------ETLKLPPRS........-IKWNVDSV..HAKNLV.......AILHLLV
PARVA_MOUSE/265-369.......FEQKVLNVSFAFE...LMQ------D.GGLEKPK.......P-RPEDIV.....NCDLK.......STLRVLY
PARVB_MOUSE/91-195.........GQKQKLQTVLE...AVQ------DLLRPHGWP........-LRWNVDSI..HGKNLV.......AILHLLV
FIMB3_ARATH/396-499.......PFRKVENCNQVVK...IGK------EM.RFSLVN.......V-AGNDIV.....QGNKK.......LILGFLW
FIMB2_ARATH/125-239T....LNPWERNENLTLGLN...SAK------AI.GCTVVN.......I-GTQDIA.....EGRPY.......LVLGLIS
FIMB2_ARATH/270-370.........DPTERAKKVLE....QA------EKLDCKRYL........-SPKDIV.....DGSAN.......LNLAFVA
FIMB2_ARATH/516-621.........DKKLNATYIIS....VA------RKLGCSIFL........-LPEDII.....EVNQK.......MMLILAA
Q9GQV2_DROME/18-120........SQKLENVSVALK...FLQ------D.EGIKIVN.......I-DSSDIV.....DCKLK.......LILGLIW
Q9GQV2_DROME/142-242.........DAVQNASEAMG...LAD------DWLNVRQLI........-KPEELVN...PNVDEQ.......SMMTYLS
SPTN4_HUMAN/183-285.........NANYNLQRAFR...TAE------QHLGLARLL........-DPEDV.NM..EAPDEK.......SIITYVV
PARVG_HUMAN/47-151.........SQKHKLTVVLE...AVN------RSLQLEEWQ........-AKWSVESI..FNKDLL.......STLHLLV
Q9I7J0_DROME/9-111G.....TNFQLMENIQRFQA...AVK------K.YGVPEEEI......F-QTADLFE....RRNIP.......QVTLSLY
ANC1_CAEEL/26-130........VHHIANLTTALT...VLR------R.RGLELIN.......N-NAADIA.....DGNPR.......IVLGLIW
ANC1_CAEEL/225-328.........NPRDNLELAFN...LAH------QHLGVRRLL........-AVEDM.MI..EKPDKR.......SVITYVS
VAV_DROME/21-137PQ...MAQFLCSKNIKLFLD...VCH------NNFGIRDADL......F-EPTMLYD....LTNFH.......RVLITLS
SPTN5_HUMAN/57-159........VHFLENSSRALA...FL.------R.AKVPVPL.......I-GPENIV.....DGDQT.......LILGLIW
SPTN5_HUMAN/180-282.........RPLHNLAFAFL...VAE------QELGIAQLL........-DPEDV.AA..AQPDER.......SIMTYVS
CAMP3_HUMAN/166-315DP...MSVADSLYNLQLVQD...FCA------SRLPRGCPL........-SLEDLLYV..PPPLKV.......NLVVMLA
Q9SJ84_ARATH/391-494.......PFKKVENCNQVIK...IGK------EL.NFSLVN.......V-AGHDIM.....QGNKK.......LLLAFLW
Q9SS42_ARATH/22-140QL...PPAYQYFENVRNFLV...ALE------T.LRLPG.........F-EASDLEKDNLESGSVT.......KVVDCIL
DMD_CAEEL/132-234.........SAIDRIENAFA...VAE------KTWNVPRLL........-NPKDL.HS..DQLDSH.......SVLCYLM
Q9TYW4_CAEEL/29-132........SQKLENVSLALN...FFQ------NEENIKIIN.......I-DSTHIV.....DHNKK.......LILGLVW
Q9TYW4_CAEEL/153-253.........DALENTEKAMK...SAQ------DLLKVAPLI........-APAEMIH...PEIDEM.......SVMTYLS
Q9U3Z8_ENTHI/13-114........IVKLDNVGFAVN...FMK------E.EKLNTSV........-SAENIV.....DGNRT.......YILGMVW
Q9U3Z8_ENTHI/132-229.........SGLDNTQMVIDCQKLAY------EQFKIPILM........-DVKDL.VC..ERPDPK.......SIMTYVS
Q9U5G9_TETTH/87-200N....LNIFKKNENLTLAIA...SAR------AI.GCVCVN.......I-TNNSII.....DKREH.......IILGLVW
Q9U5G9_TETTH/231-330.........H.LERCKKVIN....DS------KLLGVPPCI........-KPSDIV.....NGNQK.......LNLIFCA
Q9U5G9_TETTH/358-460........FTKIQNANYAVQ...LAK------DL.HLQIVG.......I-GGTDIV.....DGNKK.......LILAIVW
Q9U5G9_TETTH/469-571.........EVTNNAKYAIS....VA------RKLGAAVFL........-VWEHIR.....DVNPK.......FLMTFTA
TAGL3_HUMAN/27-137K.....MAFKQMEQISQFLK...AAE------T.YGVRTTDI......F-QTVDLWE....GKDMA.......AVQRTLM
VAV3_HUMAN/4-120PQ...MSQFLCLKNIRTFLT...ACC------ETFGMRKSEL......F-EAFDLFD....VRDFG.......KVIETLS
MARE3_HUMAN/17-116........EHEYIHNFKVLQ...AAF------KKMGVDKII........-PVEKLV.....KGKFQ.......DNFEFIQ
Q9VU34_DROME/13-116.........DIYENNDLAFT...TAE------KYLGIPALL........-DAADMVSY..EVPDRL.......SILTYLS
Q9VWD0_DROME/93-197.........GQHEKLNIVLK...AVN------HTLGFHQKI........-PKWSVASV..HSKNIV.......AILHLLV
Q9VWD0_DROME/260-364.......VDQMVSNVAFAFD...LMQ------D.VGLPKPK.......A-RPEDIV.....NMDLK.......STLRVLY
Q9VZI1_DROME/28-134K.....MAFKCMENISAFLA...CAK------N.FGVPTQET......F-QSVDLWE....RQNLN.......SVVICLQ
Q9W2W2_DROME/21-120........EYEYVNNFKELQ...KAF------NKVNVSLPA........-EVNDLI.....KGHRV.......ENFKFAV
Q9XXA2_CAEEL/17-115........EPDVLNNWKVLT...TTW------KDLGIDKPV........-DVEKMK.....KAKFQ.......DNMEFLQ
Q9XZ57_DROME/17-116........EHEYIQNFKILQ...AGF------KKMSVDKII........-PIDKLV.....KGRFQ.......DNFEFLQ
Q9XZE9_HYDVU/33-146......LHFRHTDNIMYFIR...AME------K.ISFPPVFY......P-ETTDIYD....MKNMP.......RAIYCIH
Q9YGW4_CHICK/40-143........QMKLENVSVALE...FLE------R.ERIKLVF.......I-DSKAIV.....DGNLK.......LILGLVW
Q9YGW4_CHICK/162-262.........QPVQNAREAMQ...QAD------DWLGVPQVI........-APEEIAD...PNVDEH.......SVMTYLS

PF06294

SPEF2_MOUSE/5-158QNVAQSIITEKPGAATKLLYQLYIAL...QKKKKTGLTGLEIQTMQPQT-NLRLQTLKSEAFREQRLNRRRQNEIMA...
SPEF2_HUMAN/5-153QNVAHGIITEKPGVATKLLYQLYIAL...QKKKKSGLTGVEMQTMQRLT-NLRLQNMKSDTFQERLRHMIPR........
SPAT4_MOUSE/54-210KELIHGTIHCKAGVPEILIQEIYTLL...THQEIRSIQDDLANFTDYIY-QMRLPLVPRNTVSKSIKNNIRLSELLSNPN
SPEF1_MOUSE/13-164DDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSS-GYMDMGLPQKVRGEGAP.........ALGE
Q9VXK2_DROME/17-174KDFMEQMANGVSGAAEVMLHEVIRLEKRQRLAEQRNAALRQEQLWEEND-EIKTVVVNKQI.GDGIVQVPQKMILYSLYE
Q9VT31_DROME/9-158RSELEQLASAAPGAIESLFHELIAVT......KCASPRPRPRLSVSPTS-SQKSVVIKKLANKNSVVRTLNR....SLTQ

PF06395

A5DJC8_PICGU/101-185..VSSDDMRVCKKSVYDFLL---AVK------MHLGY-------------EDE..LMISNVFSDSG-------TDFNKTL
Q0UQ03_PHANO/151-242KTDEKSLKKNEKMATYRFIQ---SCV------GELGI-------------PQESCFILGDLYGDDT-------TGFVKVT
Q6BPP7_DEBHA/160-246..VGSDDLRVCKKSVYDFLI---AVK------MHLNF-------------EDDSMFTISDVFSDNT-------HDLLKVL
A7TRQ3_VANPO/182-268..VSSDDLKICKKSIYDFIL---GCK------QHLAF-------------IDEELFTISDVFGNST-------SQLMKVL
A5E275_LODEL/193-281..VTSDDLRICKKSVYDFLS---GCK------LFLDY-------------KDDEYFTISDVFSSNT-------QDLLKVI
A2QIY3_ASPNC/61-149..TKVAEAKRPKAATFKFLH---ASL------KELGF-------------PQQDCFLITDLYGENT-------TGFTKVI
Q6CBW7_YARLI/151-244ANRASIDVRTCKRSVYDFVQ---GCK------AELGY-------------SDDELFTISNLFSENT-------GDLIKVM
A3LZC0_PICST/155-241..VGSDDLRICKKSVYDFLF---AVK------SQLNF-------------DDDMIFTISNVFSDST-------EDLLKII
Q4PBU1_USTMA/157-246.DANRSNANACKAQVMKFII---ALK------EKLGW-------------DPDDIFTVSQLYLNDT-------NGFVKVV
A7EK75_SCLS1/142-230..NKMAEPKKSKMAAFKFVE---ACM------KDLQI-------------PPGDVFALSDLFGDDT-------TGFVKVT
Q6FIT2_CANGA/203-289..ISSDDMKICKKSIYDFIL---GCK------QHFAF-------------NDEELFTISDVFSNST-------NNLLRVL
Q7S4Y3_NEUCR/92-181.RPNETEARRSKRAIMEFVK---ACL------SDLDP-------------PVTECFIVADLTGEDT-------TGFVKVT
Q0MQZ9_PENMA/62-150..EKVPEAKRPKAATFKFLQ---ACL------QDMGF-------------PQQDCFLITDLYGENT-------TGFIKNL
Q59YK6_CANAL/166-252..VSSDDLRICKKSVYDFLI---AVK------TQLNF-------------DDENMFTISNVFSDNA-------QDLIKII
Q9HF59_ASHGS/151-237..VSSDDTKICKKSIYDFIM---GLK------LHFAF-------------NDEELFTISDVFSNST-------DHFTKVL
Q2GPG0_CHAGB/100-189.APEASQSKRSKIAILRFVE---ACK------SKLML-------------PTTDVFIITDLAGNDT-------TGFVKVT
SCD1_SCHPO/105-194.SVSLENTNVCKASLYRFML---MCK------NELGL-------------TDAALFSISEIYKPST-------APLVRAL

PF11971

VAV3_MOUSE/18-103----DVR--
CAMP1_HUMAN/229-312----YAP--
VAV2_MOUSE/18-103----DVR--
Q4SMI8_TETNG/46-131----DVR--
Q1MTA1_DANRE/54-131----VVV--
Q5C317_SCHJA/159-236----SSK--
CAM1B_DANRE/244-327----YAP--
Q4RGQ5_TETNG/186-269----YSP--
Q66HU6_DANRE/210-293----YGP--
A4IIC9_XENTR/222-304----YVP--
CAMP3_MOUSE/214-296----YVP--
Q4T883_TETNG/253-335----YAP--
Q1LUF1_DANRE/220-301----YAH--
Q4RV77_TETNG/229-312----YAH--
Q4SFF1_TETNG/232-315----YAS--
A8XND4_CAEBR/147-231----YLR--
A7RQ88_NEMVE/232-316----YAS--
SSP4_DROME/189-272----YMR--
Q16SR6_AEDAE/108-191----YMR--
A0DC81_PARTE/15-97----QVE--
Q22DM0_TETTS/15-97----NAV--
Q4DT05_TRYCC/14-96----AGV--
Q52WZ6_TRYBR/14-96----AGV--
A7S652_NEMVE/9-90----HCK--
B1ARM8_MOUSE/1087-1159----CLD--
Q4S6P6_TETNG/521-596----SLP--
A7RIX2_NEMVE/866-936----RDS--

PF00307

SMTN_HUMAN/802-906SLYNHLR--
O44788_CAEEL/27-138LLAAVAQ--
PARVG_MOUSE/213-317SLFQKHS--
CAMP2_HUMAN/178-335ELFWWFE--
SPTN2_HUMAN/60-161TIILRFQ--
SPTN2_HUMAN/179-281TYYHYFS--
MICA3_HUMAN/521-624QFYEMFK--
Q9W204_DROME/174-274YFMKPGG--
Q9W204_DROME/277-376HLQWVPP--
SSP4_DROME/159-291DLFNLFE--
VAV2_HUMAN/4-120RLSLHSI--
FIMB_DICDI/119-232QIIKIGL--
FIMB_DICDI/263-365NLFNTHP--
FIMB_DICDI/382-488QLMRGHV--
FIMB_DICDI/504-608SLWQVEM--
PLSI_HUMAN/269-376NLFNTYP--
Q18109_CAEEL/17-118CLVQRYQ--
Q18109_CAEEL/128-228YFITKGA--
Q18109_CAEEL/231-332ALCSVSL--
PLST_RAT/126-239QIIKIGL--
PLST_RAT/270-378NLFNKYP--
PLST_RAT/400-506QLMRRYT--
PLST_RAT/521-627CLMGRGM--
EHBP1_HUMAN/446-548QIRAHFS--
DMDA_DROME/15-116LIALEFN--
DMDA_DROME/130-230CLYHAME--
A2AHC4_MOUSE/185-350ELFWWFE--
A4IIC9_XENTR/151-323DLYLCFE--
CAM1B_DANRE/190-346ELFWWFE--
A7RQ88_NEMVE/187-335EIFHRCE--
O01542_CAEEL/27-133SLGRVLQ--
O08614_MOUSE/34-135SIILHWQ--
O08614_MOUSE/153-255SLFEVLP--
AIN1_SCHPO/11-114TLILRFT--
AIN1_SCHPO/126-230EYFHAFS--
STG1_SCHPO/6-109SFSRYAA--
RNG2_SCHPO/44-148ALSYFLS--
CTXA_DICDI/11-115TLYRKYR--
CTXA_DICDI/127-229LFFHAYR--
CTXB_DICDI/12-117TLYRKYR--
CTXB_DICDI/129-231LFFHAFR--
PARV_CAEEL/102-206LLALHYR--
PARV_CAEEL/269-373LLFTKYK--
O17509_BOTSH/17-116WFKKFFD--
O17666_CAEEL/339-437AIIGVRV--
O17772_CAEEL/48-163ALATLLH--
O22260_ARATH/47-166AIKSYDE--
O24399_WHEAT/87-187QIFQHRN--
O24399_WHEAT/213-316QLMRFNI--
O24399_WHEAT/337-442SIMYWEP--
GAS2_HUMAN/37-157ELGRIAA--
O44727_CAEEL/30-136SLARKVE--
O49971_ARATH/74-174HIFQHRN--
O49971_ARATH/199-302QLMRYNI--
O49971_ARATH/320-425SIMYWTL--
O50064_ARATH/127-241QIIKIQL--
FIMB_SCHPO/115-233QIIRRGL--
FIMB_SCHPO/388-495QMMRMNI--
O61604_DROME/128-241QIIRIGL--
O61604_DROME/272-374NLFNNHP--
O61604_DROME/394-499QLMRAYT--
O61604_DROME/515-620CMMALDY--
LRCH4_HUMAN/537-647AVKRVGG--
ACTNB_DICDI/25-128TLILRYQ--
ACTNB_DICDI/149-249LFPKVYQ--
O77291_DROME/151-251TIILHFQ--
O77291_DROME/266-368SLYDVFP--
O80491_ARATH/57-176ALKSYRE--
ATK4_ARATH/47-163ALKSYSE--
O93547_XENLA/30-131SLAGLAK--
O93981_GIBPU/51-169QIIRRGL--
O93981_GIBPU/200-301NLFNNHP--
O93981_GIBPU/325-432QLMRKNI--
O93981_GIBPU/450-555SLMATHE--
MICA2_HUMAN/519-622KFYELFR--
O96524_TRIVA/18-122TCINKFM--
O96524_TRIVA/134-235EFFHFFA--
O97251_PLAF7/21-120WFKSFFE--
ACTN1_CHICK/148-251SFYHAFS--
ACTNA_DICDI/25-127TIILRFA--
ACTNA_DICDI/139-242QYYHHFS--
ACTN1_HUMAN/34-135TIILRFA--
GELA_DICDI/15-117TLILRYQ--
GELA_DICDI/128-227YFRDYAL--
MP20_DROME/20-123ALGRATY--
VAV_HUMAN/4-120ALSWTPI--
ACTN_DROME/150-253CYYHAFQ--
PLSI_CHICK/125-238QIIKVGL--
PLSI_CHICK/269-377NLFNTYP--
PLSI_CHICK/399-505QLMRRYT--
PLSI_CHICK/520-626CLMGRGL--
TAGL_CHICK/27-138ALGSLAV--
CNN1_CHICK/31-132ALASQAK--
PLEC_RAT/304-406SLYDAMP--
FIMB_YEAST/142-259QIIRRGL--
FIMB_YEAST/290-390HLFNTHP--
FIMB_YEAST/414-521QLMRRNI--
FIMB_YEAST/537-642SLMTLNK--
TAGL2_HUMAN/27-137NLGGLAV--
BIM1_YEAST/9-107WLKKHWI--
LRCH1_FELCA/134-245ALLDVTV--
IQGA1_HUMAN/47-160ALSLYLF--
P90545_ENTHI/11-113TLILKYQ--
P90545_ENTHI/123-223YFRHYEA--
P91888_SCHMA/27-143QLGTECQ--
SPTCB_DROME/172-274TYYHYFS--
Q03486_PHYPO/10-112TLYRKYR--
Q03486_PHYPO/124-226LFFHAFS--
SCP1_YEAST/29-137SLSRYAN--
MAL3_SCHPO/5-103WAKRFWD--
YBX7_SCHPO/67-171ALSYLLD--
IQG1_YEAST/111-218ILISMIN--
ARHG6_HUMAN/4-111AVNKATE--
CNN3_HUMAN/29-130ALAGLAK--
Q16SR6_AEDAE/65-210DLFNLFE--
Q19011_CAEEL/279-368SLNNAFP--
Q19816_CAEEL/342-462MLYKRGV--
Q23158_CAEEL/153-254CFYHAFR--
Q24109_DROME/408-509ELQGYLD--
MYPH_ECHGR/27-131ALGRTCQ--
Q26574_SCHMA/114-231QLIRRGL--
Q26574_SCHMA/262-375TLFNMYP--
Q26574_SCHMA/393-498TLMQAYI--
Q26574_SCHMA/516-618SLQLLYY--
VAV_CAEEL/40-151FLSHTKE--
Q4RGQ5_TETNG/132-288ELFWWFE--
Q4RHF5_TETNG/170-327ELLFWFE--
Q4RV77_TETNG/184-331ELFWWFE--
Q4SFF1_TETNG/178-334ELFWWFE--
Q4T883_TETNG/176-354PIAARLR--
PLSL_MOUSE/267-375NLFNKYP--
PLSL_MOUSE/518-624CLMGKGM--
Q66HU6_DANRE/156-312ELFWWFE--
PLSL_DANRE/516-621CLMARGM--
FIMB1_ARATH/126-240QLIKIQV--
FIMB1_ARATH/271-371QIFHERN--
MILK1_HUMAN/5-108QYYNHFC--
MICA1_HUMAN/511-612HFHSAFK--
Q90574_CHICK/38-141TLILHYL--
Q90574_CHICK/161-261TFPKAKL--
Q966J8_CAEEL/168-289DLFVQFE--
CLMN_HUMAN/35-139NIILFFQ--
CLMN_HUMAN/190-291QFLERFP--
Q99140_DROME/40-140TIILRFQ--
Q99140_DROME/161-265SYYHTFA--
CNN2_HUMAN/31-132ALAGKAK--
GA2L1_HUMAN/30-148EVARRGA--
SMTL1_MOUSE/346-449ELYRSLV--
EH1L1_MOUSE/1214-1316QIRAFCT--
Q9BK91_STRPU/37-138SIIAHWE--
Q9BK91_STRPU/155-257SLYKVLS--
Q9DGM6_DANRE/184-286AFYHYFS--
PARVA_MOUSE/98-202ALSQYFR--
PARVA_MOUSE/265-369NLFTKYR--
PARVB_MOUSE/91-195SLAMHFR--
FIMB3_ARATH/396-499QLMRTHM--
FIMB2_ARATH/125-239QIIKIQM--
FIMB2_ARATH/270-370QIFQHRN--
FIMB2_ARATH/516-621SIMYWSL--
Q9GQV2_DROME/18-120TLILHYS--
Q9GQV2_DROME/142-242QYPNSKL--
SPTN4_HUMAN/183-285SFYHYFS--
PARVG_HUMAN/47-151ALAKRFQ--
Q9I7J0_DROME/9-111ALGRITQ--
ANC1_CAEEL/26-130QIILHFQ--
ANC1_CAEEL/225-328QFVRMFG--
VAV_DROME/21-137KLSQCRK--
SPTN5_HUMAN/57-159VIILRFQ--
SPTN5_HUMAN/180-282LYYHYCS--
CAMP3_HUMAN/166-315ELFMCFE--
Q9SJ84_ARATH/391-494QLMRYTM--
Q9SS42_ARATH/22-140GLKAYHE--
DMD_CAEEL/132-234SLYLAMI--
Q9TYW4_CAEEL/29-132TLILHYS--
Q9TYW4_CAEEL/153-253QFPATKP--
Q9U3Z8_ENTHI/13-114TMILKYK--
Q9U3Z8_ENTHI/132-229VYKERYE--
Q9U5G9_TETTH/87-200QIIKAQM--
Q9U5G9_TETTH/231-330HLFNNCP--
Q9U5G9_TETTH/358-460QLMRKQS--
Q9U5G9_TETTH/469-571SLYHCAK--
TAGL3_HUMAN/27-137ALGSVAV--
VAV3_HUMAN/4-120RLSRTPI--
MARE3_HUMAN/17-116WFKKFFD--
Q9VU34_DROME/13-116QFYKVLG--
Q9VWD0_DROME/93-197ALVRHFR--
Q9VWD0_DROME/260-364SLFTMFR--
Q9VZI1_DROME/28-134SLGRKAS--
Q9W2W2_DROME/21-120WFRHFFN--
Q9XXA2_CAEEL/17-115WFYKFYN--
Q9XZ57_DROME/17-116WFKKFFD--
Q9XZE9_HYDVU/33-146ALSLYLY--
Q9YGW4_CHICK/40-143TLILHYS--
Q9YGW4_CHICK/162-262QFPKAKL--

PF06294

SPEF2_MOUSE/5-158..KIQAAII
SPEF2_HUMAN/5-153..QTDFNLM
SPAT4_MOUSE/54-210VLSNELKIE
SPEF1_MOUSE/13-164QLREGRPLA
Q9VXK2_DROME/17-174KVERDSHAK
Q9VT31_DROME/9-158VIERSCSID

PF06395

A5DJC8_PICGU/101-185SVVEKLA--
Q0UQ03_PHANO/151-242NVVNRVL--
Q6BPP7_DEBHA/160-246KVVNKLV--
A7TRQ3_VANPO/182-268DVVITLM--
A5E275_LODEL/193-281TFINKVL--
A2QIY3_ASPNC/61-149KMVNRVL--
Q6CBW7_YARLI/151-244RTVSMVV--
A3LZC0_PICST/155-241KVVDSVL--
Q4PBU1_USTMA/157-246RTINRLL--
A7EK75_SCLS1/142-230QVINIVL--
Q6FIT2_CANGA/203-289DVVQTLM--
Q7S4Y3_NEUCR/92-181SVINYVL--
Q0MQZ9_PENMA/62-150QALKKEL--
Q59YK6_CANAL/166-252DVINKLL--
Q9HF59_ASHGS/151-237DVVIALL--
Q2GPG0_CHAGB/100-189TVINHVL--
SCD1_SCHPO/105-194QTIELLL--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window